1423 lines
74 KiB
HTML
1423 lines
74 KiB
HTML
<?xml version="1.0" encoding="utf-8"?>
|
|
<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd">
|
|
<html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en">
|
|
|
|
<head><meta http-equiv="Content-Type" content="text/html; charset=utf-8" />
|
|
<!-- AppResources meta begin -->
|
|
<meta name="paf-app-resources" content="" />
|
|
<!-- AppResources meta end -->
|
|
|
|
<!-- TemplateResources meta begin -->
|
|
<meta name="paf_template" content="StdNCol" />
|
|
|
|
<!-- TemplateResources meta end -->
|
|
|
|
<!-- Page meta begin -->
|
|
|
|
<!-- Page meta end -->
|
|
|
|
<!-- Logger begin -->
|
|
<meta xmlns:ncbi-portal="http://ncbi.gov/portal/XSLT/namespace" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" name="ncbi_app" content="genbank" /><meta xmlns:ncbi-portal="http://ncbi.gov/portal/XSLT/namespace" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" name="ncbi_pdid" content="custom-page" />
|
|
<!-- Logger end -->
|
|
|
|
<title>Sample GenBank Record</title>
|
|
|
|
<!-- PageFixtures headcontent begin -->
|
|
|
|
<meta name="cms-local-nav-url" content="https://cms.ncbi.nlm.nih.gov//genbank/_nav" />
|
|
|
|
<!-- PageFixtures headcontent end -->
|
|
|
|
<!-- AppResources external_resources begin -->
|
|
<script type="text/javascript" src="/core/jig/1.15.6/js/jig.min.js"></script>
|
|
|
|
<!-- AppResources external_resources end -->
|
|
|
|
<!-- Page headcontent begin -->
|
|
<meta name="subsite" content="genbank" />
|
|
<meta name="path" content="genbank/samplerecord" />
|
|
<meta name="modified" content="2021-01-12T17:59:15Z" />
|
|
<link type="text/css" rel="stylesheet" href="/core/assets/genbank/css/samplerecord.css" /><meta xmlns:ncbi-portal="http://ncbi.gov/portal/XSLT/namespace" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" name="cms-edit-aux-url" content="http://cms.ncbi.nlm.nih.gov/node//edit" />
|
|
<!-- Page headcontent end -->
|
|
<!-- PageFixtures resources begin -->
|
|
<link xmlns="http://www.w3.org/1999/xhtml" type="text/css" rel="stylesheet" href="//static.pubmed.gov/portal/portal3rc.fcgi/4218191/css/4207974/4206132.css" xml:base="http://127.0.0.1/sites/static/header_footer" />
|
|
|
|
<!-- PageFixtures resources end -->
|
|
<link rel="shortcut icon" href="//www.ncbi.nlm.nih.gov/favicon.ico" /><meta name="ncbi_phid" content="CE8B66A37C7F43C100000000011C00E4.m_5" />
|
|
<meta name='referrer' content='origin-when-cross-origin'/><link type="text/css" rel="stylesheet" href="//static.pubmed.gov/portal/portal3rc.fcgi/4218137/css/4121862/3974050/3917732/251717/4108189/14534/45193/3534283/4128070/3407145/4005757/4062871.css" /><link type="text/css" rel="stylesheet" href="//static.pubmed.gov/portal/portal3rc.fcgi/4218137/css/3529741/3529739.css" media="print" /></head>
|
|
<body class=" col2 custom-page">
|
|
<div class="grid">
|
|
<div class="col twelve_col nomargin shadow">
|
|
<!-- System messages like service outage or JS required; this is handled by the TemplateResources portlet -->
|
|
<div class="sysmessages">
|
|
<noscript>
|
|
<p class="nojs">
|
|
<strong>Warning:</strong>
|
|
The NCBI web site requires JavaScript to function.
|
|
<a href="/guide/browsers/#enablejs" title="Learn how to enable JavaScript" target="_blank">more...</a>
|
|
</p>
|
|
</noscript>
|
|
</div>
|
|
<!--/.sysmessage-->
|
|
<div class="wrap">
|
|
<div class="page">
|
|
<div xmlns:xi="http://www.w3.org/2001/XInclude">
|
|
<div xmlns="http://www.w3.org/1999/xhtml" id="universal_header" xml:base="http://127.0.0.1/sites/static/header_footer">
|
|
<section class="usa-banner">
|
|
<div class="usa-accordion">
|
|
<header class="usa-banner-header">
|
|
<div class="usa-grid usa-banner-inner">
|
|
<img src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/favicons/favicon-57.png" alt="U.S. flag" />
|
|
<p>An official website of the United States government</p>
|
|
<button class="non-usa-accordion-button usa-banner-button" aria-expanded="false" aria-controls="gov-banner-top" type="button">
|
|
<span class="usa-banner-button-text">Here's how you know</span>
|
|
</button>
|
|
</div>
|
|
</header>
|
|
<div class="usa-banner-content usa-grid usa-accordion-content" id="gov-banner-top" aria-hidden="true">
|
|
<div class="usa-banner-guidance-gov usa-width-one-half">
|
|
<img class="usa-banner-icon usa-media_block-img" src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/icon-dot-gov.svg" alt="Dot gov" />
|
|
<div class="usa-media_block-body">
|
|
<p>
|
|
<strong>The .gov means it's official.</strong>
|
|
<br />
|
|
Federal government websites often end in .gov or .mil. Before
|
|
sharing sensitive information, make sure you're on a federal
|
|
government site.
|
|
</p>
|
|
</div>
|
|
</div>
|
|
<div class="usa-banner-guidance-ssl usa-width-one-half">
|
|
<img class="usa-banner-icon usa-media_block-img" src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/icon-https.svg" alt="Https" />
|
|
<div class="usa-media_block-body">
|
|
<p>
|
|
<strong>The site is secure.</strong>
|
|
<br />
|
|
The <strong>https://</strong> ensures that you are connecting to the
|
|
official website and that any information you provide is encrypted
|
|
and transmitted securely.
|
|
</p>
|
|
</div>
|
|
</div>
|
|
</div>
|
|
</div>
|
|
</section>
|
|
<div class="usa-overlay"></div>
|
|
<header class="ncbi-header" role="banner" data-section="Header">
|
|
|
|
<div class="usa-grid">
|
|
<div class="usa-width-one-whole">
|
|
|
|
<div class="ncbi-header__logo">
|
|
<a href="/" class="logo" aria-label="NCBI Logo" data-ga-action="click_image" data-ga-label="NIH NLM Logo">
|
|
<img src="https://www.ncbi.nlm.nih.gov/coreutils/nwds/img/logos/AgencyLogo.svg" alt="NIH NLM Logo" />
|
|
</a>
|
|
</div>
|
|
|
|
<div class="ncbi-header__account">
|
|
<a id="account_login" href="https://account.ncbi.nlm.nih.gov" class="usa-button header-button" style="display:none" data-ga-action="open_menu" data-ga-label="account_menu">Log in</a>
|
|
<button id="account_info" class="header-button" style="display:none" aria-controls="account_popup" type="button">
|
|
<span class="fa fa-user" aria-hidden="true">
|
|
<svg xmlns="http://www.w3.org/2000/svg" viewBox="0 0 24 24" width="20px" height="20px">
|
|
<g style="fill: #fff">
|
|
<ellipse cx="12" cy="8" rx="5" ry="6"></ellipse>
|
|
<path d="M21.8,19.1c-0.9-1.8-2.6-3.3-4.8-4.2c-0.6-0.2-1.3-0.2-1.8,0.1c-1,0.6-2,0.9-3.2,0.9s-2.2-0.3-3.2-0.9 C8.3,14.8,7.6,14.7,7,15c-2.2,0.9-3.9,2.4-4.8,4.2C1.5,20.5,2.6,22,4.1,22h15.8C21.4,22,22.5,20.5,21.8,19.1z"></path>
|
|
</g>
|
|
</svg>
|
|
</span>
|
|
<span class="username desktop-only" aria-hidden="true" id="uname_short"></span>
|
|
<span class="sr-only">Show account info</span>
|
|
</button>
|
|
</div>
|
|
|
|
<div class="ncbi-popup-anchor">
|
|
<div class="ncbi-popup account-popup" id="account_popup" aria-hidden="true">
|
|
<div class="ncbi-popup-head">
|
|
<button class="ncbi-close-button" data-ga-action="close_menu" data-ga-label="account_menu" type="button">
|
|
<span class="fa fa-times">
|
|
<svg xmlns="http://www.w3.org/2000/svg" viewBox="0 0 48 48" width="24px" height="24px">
|
|
<path d="M38 12.83l-2.83-2.83-11.17 11.17-11.17-11.17-2.83 2.83 11.17 11.17-11.17 11.17 2.83 2.83 11.17-11.17 11.17 11.17 2.83-2.83-11.17-11.17z"></path>
|
|
</svg>
|
|
</span>
|
|
<span class="usa-sr-only">Close</span></button>
|
|
<h4>Account</h4>
|
|
</div>
|
|
<div class="account-user-info">
|
|
Logged in as:<br />
|
|
<b><span class="username" id="uname_long">username</span></b>
|
|
</div>
|
|
<div class="account-links">
|
|
<ul class="usa-unstyled-list">
|
|
<li><a id="account_myncbi" href="/myncbi/" class="set-base-url" data-ga-action="click_menu_item" data-ga-label="account_myncbi">Dashboard</a></li>
|
|
<li><a id="account_pubs" href="/myncbi/collections/bibliography/" class="set-base-url" data-ga-action="click_menu_item" data-ga-label="account_pubs">Publications</a></li>
|
|
<li><a id="account_settings" href="/account/settings/" class="set-base-url" data-ga-action="click_menu_item" data-ga-label="account_settings">Account settings</a></li>
|
|
<li><a id="account_logout" href="/account/signout/" class="set-base-url" data-ga-action="click_menu_item" data-ga-label="account_logout">Log out</a></li>
|
|
</ul>
|
|
</div>
|
|
</div>
|
|
</div>
|
|
|
|
</div>
|
|
</div>
|
|
</header>
|
|
<div role="navigation" aria-label="access keys">
|
|
<a id="nws_header_accesskey_0" href="https://www.ncbi.nlm.nih.gov/guide/browsers/#ncbi_accesskeys" class="usa-sr-only" accesskey="0" tabindex="-1">Access keys</a>
|
|
<a id="nws_header_accesskey_1" href="https://www.ncbi.nlm.nih.gov" class="usa-sr-only" accesskey="1" tabindex="-1">NCBI Homepage</a>
|
|
<a id="nws_header_accesskey_2" href="/myncbi/" class="set-base-url usa-sr-only" accesskey="2" tabindex="-1">MyNCBI Homepage</a>
|
|
<a id="nws_header_accesskey_3" href="#maincontent" class="usa-sr-only" accesskey="3" tabindex="-1">Main Content</a>
|
|
<a id="nws_header_accesskey_4" href="#" class="usa-sr-only" accesskey="4" tabindex="-1">Main Navigation</a>
|
|
</div>
|
|
<section data-section="Alerts">
|
|
<div class="ncbi-alerts-placeholder"></div>
|
|
</section>
|
|
</div>
|
|
</div>
|
|
<!--/.header-->
|
|
<div class="header">
|
|
<div class="res_logo"><h1 class="res_name"><a href="/genbank/" title="GenBank home">GenBank</a></h1><h2 class="res_tagline">Public nucleic acid sequence repository</h2></div>
|
|
<div class="search"><form method="get" action="/nuccore/"><div class="search_form"><label for="database" class="offscreen_noflow">Search database</label><select id="database"><optgroup label="Recent"><option value="nuccore" selected="selected">Nucleotide</option><option value="books">Books</option><option value="gquery">All Databases</option><option value="refseq" class="last">RefSeq</option></optgroup><optgroup label="All"><option value="gquery">All Databases</option><option value="assembly">Assembly</option><option value="biocollections">Biocollections</option><option value="bioproject">BioProject</option><option value="biosample">BioSample</option><option value="books">Books</option><option value="clinvar">ClinVar</option><option value="cdd">Conserved Domains</option><option value="gap">dbGaP</option><option value="dbvar">dbVar</option><option value="gene">Gene</option><option value="genome">Genome</option><option value="gds">GEO DataSets</option><option value="geoprofiles">GEO Profiles</option><option value="gtr">GTR</option><option value="ipg">Identical Protein Groups</option><option value="medgen">MedGen</option><option value="mesh">MeSH</option><option value="nlmcatalog">NLM Catalog</option><option value="nuccore">Nucleotide</option><option value="omim">OMIM</option><option value="pmc">PMC</option><option value="protein">Protein</option><option value="proteinclusters">Protein Clusters</option><option value="protfam">Protein Family Models</option><option value="pcassay">PubChem BioAssay</option><option value="pccompound">PubChem Compound</option><option value="pcsubstance">PubChem Substance</option><option value="pubmed">PubMed</option><option value="snp">SNP</option><option value="sra">SRA</option><option value="structure">Structure</option><option value="taxonomy">Taxonomy</option><option value="toolkit">ToolKit</option><option value="toolkitall">ToolKitAll</option><option value="toolkitbookgh">ToolKitBookgh</option></optgroup></select><div class="nowrap"><label for="term" class="offscreen_noflow" accesskey="/">Search term</label><div class="nowrap"><input type="text" name="term" id="term" title="Search Nucleotide" value="" class="jig-ncbiclearbutton jig-ncbiautocomplete" data-jigconfig="isEnabled:false,disableUrl:'NcbiSearchBarAutoComplCtrl'" autocomplete="off" data-sbconfig="ds:'no',pjs:'no',afs:'yes'" /></div><button id="search" type="submit" class="button_search nowrap" cmd="go">Search</button></div></div></form></div>
|
|
|
|
</div>
|
|
<div class="nav_and_browser">
|
|
<div class="localnav"><ul class="jig-ncbilocalnav">
|
|
<li><a href="#">GenBank</a><ul>
|
|
<li><a href="/genbank/">About GenBank</a></li>
|
|
<li><a href="/genbank/submit_types">Submission Types</a></li>
|
|
<li><a href="/genbank/submit">Submission Tools</a></li>
|
|
<li><a href="/genbank/update">Update GenBank Records</a></li>
|
|
<li><a href="/nuccore/">Search</a></li>
|
|
<li><a href="/BLAST/Blast.cgi?CMD=Web&PAGETYPE=BLASTHome">BLAST</a></li>
|
|
<li><a href="/genbank/statistics">Statistics</a></li>
|
|
<li><a href="/genbank/samplerecord/">Sample Record</a></li>
|
|
<li><a href="/genbank/sequencerevisionhistory/">Revision History</a></li>
|
|
<li><a href="/genbank/sequenceids/">Sequence IDs</a></li>
|
|
</ul>
|
|
</li>
|
|
<li><a href="#">Submit</a><ul>
|
|
<li><a href="/genbank/submit">Submission Tools</a></li>
|
|
<li><a href="/genbank/submit_types">Submission Types</a></li>
|
|
<li><a href="/WebSub/?tool=genbank">BankIt</a></li>
|
|
<li><a href="/genbank/table2asn">table2asn</a></li>
|
|
<li><a href="https://www.ncbi.nlm.nih.gov/sra/docs/sequence-data-processing">Sequence Data Processing</a></li>
|
|
</ul>
|
|
</li>
|
|
<li><a href="#">Genomes</a><ul>
|
|
<li><a href="/genbank/genomesubmit">Complete Genome Submission Guide</a></li>
|
|
<li><a href="/genbank/genomesubmit_annotation">Prokaryotic Genome Annotation Guide</a></li>
|
|
<li><a href="/genbank/eukaryotic_genome_submission_annotation">Eukaryotic Genome Annotation Guide</a></li>
|
|
<li><a href="/genbank/examples.wgs">Annotation Examples</a></li>
|
|
<li><a href="https://submit.ncbi.nlm.nih.gov/subs/wgs/">Genome Submission Portal</a></li>
|
|
</ul>
|
|
</li>
|
|
<li><a title="Whole Genome Shotgun sequences and submissions" href="#">WGS</a><ul>
|
|
<li><a href="/genbank/wgs">About WGS</a></li>
|
|
<li><a href="/Traces/wgs">WGS Project List</a></li>
|
|
<li><a href="/genbank/wgs.submit">WGS Submission Guide</a></li>
|
|
<li><a href="/genbank/wgsfaq/">FAQ</a></li>
|
|
<li><a href="https://submit.ncbi.nlm.nih.gov/subs/wgs/">Genome Submission Portal</a></li>
|
|
<li><a href="/genbank/eukaryotic_genome_submission_annotation">Eukaryotic Annotation Guide</a></li>
|
|
<li><a href="/genbank/genomesubmit_annotation">Prokaryotic Annotation Guide</a></li>
|
|
<li><a href="/genbank/asndisc">Discrepancy Report</a></li>
|
|
<li><a href="/assembly/agp/AGP_Specification/">AGP format</a></li>
|
|
</ul>
|
|
</li>
|
|
<li><a href="#">Metagenomes</a><ul>
|
|
<li><a href="/genbank/metagenome">About Metagenomes</a></li>
|
|
<li><a href="/genbank/structuredcomment">Structured Comment</a></li>
|
|
</ul>
|
|
</li>
|
|
<li><a href="#">TPA</a><ul>
|
|
<li><a href="/genbank/TPA">About TPA</a></li>
|
|
<li><a href="/genbank/tpafaq">FAQ</a></li>
|
|
<li><a href="/genbank/TPA-Exp">TPA-Exp</a></li>
|
|
<li><a href="/genbank/TPA-Inf">TPA-Inf</a></li>
|
|
</ul>
|
|
</li>
|
|
<li><a href="#">TSA</a><ul>
|
|
<li><a href="/genbank/TSA">About TSA</a></li>
|
|
<li><a href="/genbank/TSAguide">TSA Submission Guide</a></li>
|
|
<li><a href="/genbank/TSAfaq">FAQ</a></li>
|
|
</ul>
|
|
</li>
|
|
<li><a href="#">INSDC</a><ul>
|
|
<li><a href="/genbank/collab">About INSDC</a></li>
|
|
<li><a href="/genbank/collab/country">Geographic Location Name List</a></li>
|
|
<li><a href="/genbank/collab/db_xref">db_xref List</a></li>
|
|
<li><a href="http://www.insdc.org/documents/feature_table.html">Feature Table</a></li>
|
|
</ul>
|
|
</li>
|
|
<li><a href="#">Documentation</a><ul>
|
|
<li><a href="https://www.ncbi.nlm.nih.gov/sra/docs/sequence-data-processing/">Sequence Data Processing</a></li>
|
|
<li><a href="/genbank/submission_brokers">Submission Brokers</a></li>
|
|
<li><a href="/genbank/acc_prefix">Accession Number Prefixes</a></li>
|
|
<li><a href="/genbank/organelle_submit/">Organelle Submission Guide</a></li>
|
|
<li><a href="/genbank/monkeypox_submission/">Monkeypox Submission Guide</a></li>
|
|
<li><a href="/genbank/validation/">Common Submission Errors</a> </li>
|
|
<li><a href="/genbank/sequencecheck/">Ribosomal Submission Errors</a></li>
|
|
<li><a href="/genbank/sequencecheck/virus">Common Sequence Errors</a></li>
|
|
<li><a href="https://support.nlm.nih.gov/knowledgebase/category/?id=CAT-01240">Submission FAQs</a></li>
|
|
</ul>
|
|
</li>
|
|
<li><a href="#">Other</a><ul>
|
|
<li><a href="/genbank/htgs">About HTGs</a></li>
|
|
<li><a href="/genbank/dbest">About EST</a></li>
|
|
<li><a href="/genbank/dbgss">About GSS</a></li>
|
|
<li><a href="/genbank/tls">About TLS</a></li>
|
|
<li><a href="/genbank/tlsguide">Submit TLS</a></li>
|
|
</ul>
|
|
</li>
|
|
</ul></div>
|
|
</div>
|
|
|
|
<!-- was itemctrl -->
|
|
<div class="container">
|
|
<div id="maincontent" class="content col twelve_col last">
|
|
<div class="col1">
|
|
<h1 id="sample-genbank-record">Sample GenBank Record</h1>
|
|
|
|
|
|
<p>This page presents an annotated sample GenBank record (accession
|
|
number <code>U49845</code>) in its <em>GenBank Flat File</em> format. You can see the
|
|
corresponding <a href="/nucleotide/U49845">live record for U49845</a>, and see
|
|
<a href="#OtherFeaturesB">examples of other records</a> that show a range of
|
|
biological features.</p>
|
|
|
|
|
|
<p><pre>
|
|
<a id="LocusA" href="#LocusB">LOCUS</a> <a id="LocusNameA" href="#LocusNameB">SCU49845</a> <a id="SequenceLengthA" href="#SequenceLengthB">5028 bp</a> <a id="MoleculeTypeA" href="#MoleculeTypeB">DNA</a> <a id="GenBankDivisionA" href="#GenBankDivisionB">PLN</a> <a id="ModificationDateA" href="#ModificationDateB">21-JUN-1999</a>
|
|
<a id="DefinitionA" href="#DefinitionB">DEFINITION</a> Saccharomyces cerevisiae TCP1-beta gene, partial cds, and Axl2p
|
|
(AXL2) and Rev7p (REV7) genes, complete cds.
|
|
<a id="AccessionA" href="#AccessionB">ACCESSION</a> U49845
|
|
<a id="VersionA" href="#VersionB">VERSION</a> U49845.1 <a id="GInA" href="#GInB">GI</a>:1293613
|
|
<a id="KeywordsA" href="#KeywordsB">KEYWORDS</a> .
|
|
<a id="SourceA" href="#SourceB">SOURCE</a> Saccharomyces cerevisiae (baker's yeast)
|
|
<a id="OrganismA" href="#OrganismB">ORGANISM</a> Saccharomyces cerevisiae
|
|
Eukaryota; Fungi; Ascomycota; Saccharomycotina; Saccharomycetes;
|
|
Saccharomycetales; Saccharomycetaceae; Saccharomyces.
|
|
<a id="ReferenceA" href="#ReferenceB">REFERENCE</a> 1 (bases 1 to 5028)
|
|
<a id="AuthorsA" href="#AuthorsB">AUTHORS</a> Torpey,L.E., Gibbs,P.E., Nelson,J. and Lawrence,C.W.
|
|
<a id="TitleA" href="#TitleB">TITLE</a> Cloning and sequence of REV7, a gene whose function is required for
|
|
DNA damage-induced mutagenesis in Saccharomyces cerevisiae
|
|
<a id="JournalA" href="#JournalB">JOURNAL</a> Yeast 10 (11), 1503-1509 (1994)
|
|
<a id="PubMedA" href="#PubMedB">PUBMED</a> 7871890
|
|
REFERENCE 2 (bases 1 to 5028)
|
|
AUTHORS Roemer,T., Madden,K., Chang,J. and Snyder,M.
|
|
TITLE Selection of axial growth sites in yeast requires Axl2p, a novel
|
|
plasma membrane glycoprotein
|
|
JOURNAL Genes Dev. 10 (7), 777-793 (1996)
|
|
PUBMED 8846915
|
|
REFERENCE 3 (bases 1 to 5028)
|
|
AUTHORS Roemer,T.
|
|
TITLE <a id="SubmitterBlockA" href="#SubmitterBlockB">Direct Submission</a>
|
|
JOURNAL Submitted (22-FEB-1996) Terry Roemer, Biology, Yale University, New
|
|
Haven, CT, USA
|
|
<a id="FeaturesA" href="#FeaturesB">FEATURES</a> Location/Qualifiers
|
|
<a id="FeaturesSourceA" href="#FeaturesSourceB">source</a> 1..5028
|
|
/organism="Saccharomyces cerevisiae"
|
|
/<a id="TaxonA" href="#TaxonB">db_xref="taxon:4932"</a>
|
|
/chromosome="IX"
|
|
/map="9"
|
|
<a id="CDSA" href="#CDSB">CDS</a> <a id="BaseSpanA" href="#BaseSpanB"><1..206</a>
|
|
/codon_start=3
|
|
/product="TCP1-beta"
|
|
<a id="ProteinIDA" href="#ProteinIDB">/protein_id</a>="AAA98665.1"
|
|
/db_xref="<a id="GIpA" href="#GIpB">GI</a>:1293614"
|
|
<a id="TranslationA" href="#TranslationB">/translation</a>="SSIYNGISTSGLDLNNGTIADMRQLGIVESYKLKRAVVSSASEA
|
|
AEVLLRVDNIIRARPRTANRQHM"
|
|
<a id="GeneA" href="#GeneB">gene</a> 687..3158
|
|
/gene="AXL2"
|
|
CDS 687..3158
|
|
/gene="AXL2"
|
|
/note="plasma membrane glycoprotein"
|
|
/codon_start=1
|
|
/function="required for axial budding pattern of S.
|
|
cerevisiae"
|
|
/product="Axl2p"
|
|
<a href="#ProteinIDB">/protein_id</a>="AAA98666.1"
|
|
/db_xref="<a href="#GIpB">GI</a>:1293615"
|
|
<a href="#TranslationB">/translation</a>="MTQLQISLLLTATISLLHLVVATPYEAYPIGKQYPPVARVNESF
|
|
TFQISNDTYKSSVDKTAQITYNCFDLPSWLSFDSSSRTFSGEPSSDLLSDANTTLYFN
|
|
VILEGTDSADSTSLNNTYQFVVTNRPSISLSSDFNLLALLKNYGYTNGKNALKLDPNE
|
|
VFNVTFDRSMFTNEESIVSYYGRSQLYNAPLPNWLFFDSGELKFTGTAPVINSAIAPE
|
|
TSYSFVIIATDIEGFSAVEVEFELVIGAHQLTTSIQNSLIINVTDTGNVSYDLPLNYV
|
|
YLDDDPISSDKLGSINLLDAPDWVALDNATISGSVPDELLGKNSNPANFSVSIYDTYG
|
|
DVIYFNFEVVSTTDLFAISSLPNINATRGEWFSYYFLPSQFTDYVNTNVSLEFTNSSQ
|
|
DHDWVKFQSSNLTLAGEVPKNFDKLSLGLKANQGSQSQELYFNIIGMDSKITHSNHSA
|
|
NATSTRSSHHSTSTSSYTSSTYTAKISSTSAAATSSAPAALPAANKTSSHNKKAVAIA
|
|
CGVAIPLGVILVALICFLIFWRRRRENPDDENLPHAISGPDLNNPANKPNQENATPLN
|
|
NPFDDDASSYDDTSIARRLAALNTLKLDNHSATESDISSVDEKRDSLSGMNTYNDQFQ
|
|
SQSKEELLAKPPVQPPESPFFDPQNRSSSVYMDSEPAVNKSWRYTGNLSPVSDIVRDS
|
|
YGSQKTVDTEKLFDLEAPEKEKRTSRDVTMSSLDPWNSNISPSPVRKSVTPSPYNVTK
|
|
HRNRHLQNIQDSQSGKNGITPTTMSTSSSDDFVPVKDGENFCWVHSMEPDRRPSKKRL
|
|
VDFSNKSNVNVGQVKDIHGRIPEML"
|
|
gene <a id="ComplementA" href="#ComplementB">complement</a>(3300..4037)
|
|
/gene="REV7"
|
|
CDS <a href="#ComplementB">complement</a>(3300..4037)
|
|
/gene="REV7"
|
|
/codon_start=1
|
|
/product="Rev7p"
|
|
<a href="#ProteinIDB">/protein_id</a>="AAA98667.1"
|
|
/db_xref="<a href="#GIpB">GI</a>:1293616"
|
|
<a href="#TranslationB">/translation</a>="MNRWVEKWLRVYLKCYINLILFYRNVYPPQSFDYTTYQSFNLPQ
|
|
FVPINRHPALIDYIEELILDVLSKLTHVYRFSICIINKKNDLCIEKYVLDFSELQHVD
|
|
KDDQIITETEVFDEFRSSLNSLIMHLEKLPKVNDDTITFEAVINAIELELGHKLDRNR
|
|
RVDSLEEKAEIERDSNWVKCQEDENLPDNNGFQPPKIKLTSLVGSDVGPLIIHQFSEK
|
|
LISGDDKILNGVYSQYEEGESIFGSLF"
|
|
<a id="OriginA" href="#OriginB">ORIGIN</a>
|
|
1 gatcctccat atacaacggt atctccacct caggtttaga tctcaacaac ggaaccattg
|
|
61 ccgacatgag acagttaggt atcgtcgaga gttacaagct aaaacgagca gtagtcagct
|
|
121 ctgcatctga agccgctgaa gttctactaa gggtggataa catcatccgt gcaagaccaa
|
|
181 gaaccgccaa tagacaacat atgtaacata tttaggatat acctcgaaaa taataaaccg
|
|
241 ccacactgtc attattataa ttagaaacag aacgcaaaaa ttatccacta tataattcaa
|
|
301 agacgcgaaa aaaaaagaac aacgcgtcat agaacttttg gcaattcgcg tcacaaataa
|
|
361 attttggcaa cttatgtttc ctcttcgagc agtactcgag ccctgtctca agaatgtaat
|
|
421 aatacccatc gtaggtatgg ttaaagatag catctccaca acctcaaagc tccttgccga
|
|
481 gagtcgccct cctttgtcga gtaattttca cttttcatat gagaacttat tttcttattc
|
|
541 tttactctca catcctgtag tgattgacac tgcaacagcc accatcacta gaagaacaga
|
|
601 acaattactt aatagaaaaa ttatatcttc ctcgaaacga tttcctgctt ccaacatcta
|
|
661 cgtatatcaa gaagcattca cttaccatga cacagcttca gatttcatta ttgctgacag
|
|
721 ctactatatc actactccat ctagtagtgg ccacgcccta tgaggcatat cctatcggaa
|
|
781 aacaataccc cccagtggca agagtcaatg aatcgtttac atttcaaatt tccaatgata
|
|
841 cctataaatc gtctgtagac aagacagctc aaataacata caattgcttc gacttaccga
|
|
901 gctggctttc gtttgactct agttctagaa cgttctcagg tgaaccttct tctgacttac
|
|
961 tatctgatgc gaacaccacg ttgtatttca atgtaatact cgagggtacg gactctgccg
|
|
1021 acagcacgtc tttgaacaat acataccaat ttgttgttac aaaccgtcca tccatctcgc
|
|
1081 tatcgtcaga tttcaatcta ttggcgttgt taaaaaacta tggttatact aacggcaaaa
|
|
1141 acgctctgaa actagatcct aatgaagtct tcaacgtgac ttttgaccgt tcaatgttca
|
|
1201 ctaacgaaga atccattgtg tcgtattacg gacgttctca gttgtataat gcgccgttac
|
|
1261 ccaattggct gttcttcgat tctggcgagt tgaagtttac tgggacggca ccggtgataa
|
|
1321 actcggcgat tgctccagaa acaagctaca gttttgtcat catcgctaca gacattgaag
|
|
1381 gattttctgc cgttgaggta gaattcgaat tagtcatcgg ggctcaccag ttaactacct
|
|
1441 ctattcaaaa tagtttgata atcaacgtta ctgacacagg taacgtttca tatgacttac
|
|
1501 ctctaaacta tgtttatctc gatgacgatc ctatttcttc tgataaattg ggttctataa
|
|
1561 acttattgga tgctccagac tgggtggcat tagataatgc taccatttcc gggtctgtcc
|
|
1621 cagatgaatt actcggtaag aactccaatc ctgccaattt ttctgtgtcc atttatgata
|
|
1681 cttatggtga tgtgatttat ttcaacttcg aagttgtctc cacaacggat ttgtttgcca
|
|
1741 ttagttctct tcccaatatt aacgctacaa ggggtgaatg gttctcctac tattttttgc
|
|
1801 cttctcagtt tacagactac gtgaatacaa acgtttcatt agagtttact aattcaagcc
|
|
1861 aagaccatga ctgggtgaaa ttccaatcat ctaatttaac attagctgga gaagtgccca
|
|
1921 agaatttcga caagctttca ttaggtttga aagcgaacca aggttcacaa tctcaagagc
|
|
1981 tatattttaa catcattggc atggattcaa agataactca ctcaaaccac agtgcgaatg
|
|
2041 caacgtccac aagaagttct caccactcca cctcaacaag ttcttacaca tcttctactt
|
|
2101 acactgcaaa aatttcttct acctccgctg ctgctacttc ttctgctcca gcagcgctgc
|
|
2161 cagcagccaa taaaacttca tctcacaata aaaaagcagt agcaattgcg tgcggtgttg
|
|
2221 ctatcccatt aggcgttatc ctagtagctc tcatttgctt cctaatattc tggagacgca
|
|
2281 gaagggaaaa tccagacgat gaaaacttac cgcatgctat tagtggacct gatttgaata
|
|
2341 atcctgcaaa taaaccaaat caagaaaacg ctacaccttt gaacaacccc tttgatgatg
|
|
2401 atgcttcctc gtacgatgat acttcaatag caagaagatt ggctgctttg aacactttga
|
|
2461 aattggataa ccactctgcc actgaatctg atatttccag cgtggatgaa aagagagatt
|
|
2521 ctctatcagg tatgaataca tacaatgatc agttccaatc ccaaagtaaa gaagaattat
|
|
2581 tagcaaaacc cccagtacag cctccagaga gcccgttctt tgacccacag aataggtctt
|
|
2641 cttctgtgta tatggatagt gaaccagcag taaataaatc ctggcgatat actggcaacc
|
|
2701 tgtcaccagt ctctgatatt gtcagagaca gttacggatc acaaaaaact gttgatacag
|
|
2761 aaaaactttt cgatttagaa gcaccagaga aggaaaaacg tacgtcaagg gatgtcacta
|
|
2821 tgtcttcact ggacccttgg aacagcaata ttagcccttc tcccgtaaga aaatcagtaa
|
|
2881 caccatcacc atataacgta acgaagcatc gtaaccgcca cttacaaaat attcaagact
|
|
2941 ctcaaagcgg taaaaacgga atcactccca caacaatgtc aacttcatct tctgacgatt
|
|
3001 ttgttccggt taaagatggt gaaaattttt gctgggtcca tagcatggaa ccagacagaa
|
|
3061 gaccaagtaa gaaaaggtta gtagattttt caaataagag taatgtcaat gttggtcaag
|
|
3121 ttaaggacat tcacggacgc atcccagaaa tgctgtgatt atacgcaacg atattttgct
|
|
3181 taattttatt ttcctgtttt attttttatt agtggtttac agatacccta tattttattt
|
|
3241 agtttttata cttagagaca tttaatttta attccattct tcaaatttca tttttgcact
|
|
3301 taaaacaaag atccaaaaat gctctcgccc tcttcatatt gagaatacac tccattcaaa
|
|
3361 attttgtcgt caccgctgat taatttttca ctaaactgat gaataatcaa aggccccacg
|
|
3421 tcagaaccga ctaaagaagt gagttttatt ttaggaggtt gaaaaccatt attgtctggt
|
|
3481 aaattttcat cttcttgaca tttaacccag tttgaatccc tttcaatttc tgctttttcc
|
|
3541 tccaaactat cgaccctcct gtttctgtcc aacttatgtc ctagttccaa ttcgatcgca
|
|
3601 ttaataactg cttcaaatgt tattgtgtca tcgttgactt taggtaattt ctccaaatgc
|
|
3661 ataatcaaac tatttaagga agatcggaat tcgtcgaaca cttcagtttc cgtaatgatc
|
|
3721 tgatcgtctt tatccacatg ttgtaattca ctaaaatcta aaacgtattt ttcaatgcat
|
|
3781 aaatcgttct ttttattaat aatgcagatg gaaaatctgt aaacgtgcgt taatttagaa
|
|
3841 agaacatcca gtataagttc ttctatatag tcaattaaag caggatgcct attaatggga
|
|
3901 acgaactgcg gcaagttgaa tgactggtaa gtagtgtagt cgaatgactg aggtgggtat
|
|
3961 acatttctat aaaataaaat caaattaatg tagcatttta agtataccct cagccacttc
|
|
4021 tctacccatc tattcataaa gctgacgcaa cgattactat tttttttttc ttcttggatc
|
|
4081 tcagtcgtcg caaaaacgta taccttcttt ttccgacctt ttttttagct ttctggaaaa
|
|
4141 gtttatatta gttaaacagg gtctagtctt agtgtgaaag ctagtggttt cgattgactg
|
|
4201 atattaagaa agtggaaatt aaattagtag tgtagacgta tatgcatatg tatttctcgc
|
|
4261 ctgtttatgt ttctacgtac ttttgattta tagcaagggg aaaagaaata catactattt
|
|
4321 tttggtaaag gtgaaagcat aatgtaaaag ctagaataaa atggacgaaa taaagagagg
|
|
4381 cttagttcat cttttttcca aaaagcaccc aatgataata actaaaatga aaaggatttg
|
|
4441 ccatctgtca gcaacatcag ttgtgtgagc aataataaaa tcatcacctc cgttgccttt
|
|
4501 agcgcgtttg tcgtttgtat cttccgtaat tttagtctta tcaatgggaa tcataaattt
|
|
4561 tccaatgaat tagcaatttc gtccaattct ttttgagctt cttcatattt gctttggaat
|
|
4621 tcttcgcact tcttttccca ttcatctctt tcttcttcca aagcaacgat ccttctaccc
|
|
4681 atttgctcag agttcaaatc ggcctctttc agtttatcca ttgcttcctt cagtttggct
|
|
4741 tcactgtctt ctagctgttg ttctagatcc tggtttttct tggtgtagtt ctcattatta
|
|
4801 gatctcaagt tattggagtc ttcagccaat tgctttgtat cagacaattg actctctaac
|
|
4861 ttctccactt cactgtcgag ttgctcgttt ttagcggaca aagatttaat ctcgttttct
|
|
4921 ttttcagtgt tagattgctc taattctttg agctgttctc tcagctcctc atatttttct
|
|
4981 tgccatgact cagattctaa ttttaagcta ttcaatttct ctttgatc
|
|
//
|
|
|
|
</pre>
|
|
</p>
|
|
|
|
|
|
<h2 id="field-comments">FIELD COMMENTS</h2>
|
|
|
|
|
|
<h3 id="LocusB"><a href="#LocusA">LOCUS</a></h3>
|
|
|
|
|
|
<p>The LOCUS field contains a number of different data elements,
|
|
including locus name, sequence length, molecule type, GenBank
|
|
division, and modification date. Each element is described below.</p>
|
|
|
|
|
|
<h3 id="locus-name">Locus Name</h3>
|
|
|
|
|
|
<p>The locus name in this example is <a href="#LocusA">SCU49845</a>.</p>
|
|
|
|
|
|
<p>The locus name was originally designed to help group entries with
|
|
similar sequences: the first three characters usually designated the
|
|
organism; the fourth and fifth characters were used to show other
|
|
group designations, such as gene product; for segmented entries, the
|
|
last character was one of a series of sequential integers. (See
|
|
GenBank <a href="https://ftp.ncbi.nih.gov/genbank/gbrel.txt">release notes</a>
|
|
section 3.4.4 for more info.)</p>
|
|
|
|
|
|
<p>However, the 10 characters in the locus name are no longer sufficient
|
|
to represent the amount of information originally intended to be
|
|
contained in the locus name. The only rule now applied in assigning a
|
|
locus name is that it must be unique. For example, for GenBank records
|
|
that have 6-character accessions (e.g., U12345), the locus name is
|
|
usually the first letter of the genus and species names, followed by
|
|
the accession number. For 8-character character accessions (e.g.,
|
|
AF123456), the locus name is just the accession number.</p>
|
|
|
|
|
|
<p>The <a href="/refseq/">RefSeq</a> database of reference sequences assigns formal
|
|
locus names to each record, based on gene symbol. RefSeq is separate
|
|
from the GenBank database, but contains cross-references to
|
|
corresponding GenBank records.</p>
|
|
|
|
|
|
<p>Entrez Search Field: Accession Number [ACCN] Search Tip : It is
|
|
better to search for the actual accession number rather than the locus
|
|
name, because the accessions are stable and locus names can change.</p>
|
|
|
|
|
|
<h3 id="SequenceLengthB"><a href="#SequenceLengthA">Sequence Length</a></h3>
|
|
|
|
|
|
<p>Number of nucleotide base pairs (or amino acid residues) in the
|
|
sequence record. In this example, the sequence length is <a href="#SequenceLengthA">5028 bp</a>.</p>
|
|
|
|
|
|
<p>Entrez Search Field : Sequence Length [SLEN] Search Tips : (1) To
|
|
retrieve records within a range of lengths, use the colon as the range
|
|
operator, e.g., 2500:2600[SLEN]. (2) To retrieve all sequences
|
|
shorter than a certain number, use 2 as the lower bound, e.g.,
|
|
2:100[SLEN]. (3) To retrieve all sequences longer than a certain
|
|
number, use a series of 9's as the upper bound, e.g.,
|
|
325000:99999999[SLEN].</p>
|
|
|
|
|
|
<h3 id="MoleculeTypeB"><a href="#MoleculeTypeA">Molecule Type</a></h3>
|
|
|
|
|
|
<p>The type of molecule that was sequenced. In this example, the molecule type is <a href="#MoleculeTypeA">DNA</a>.</p>
|
|
|
|
|
|
<p>Each GenBank record must contain contiguous sequence data from a
|
|
single molecule type. The various <a href="https://www.ncbi.nlm.nih.gov/Sequin//sequin.hlp.html#SpecifyMolecule">molecule types</a>
|
|
can include genomic DNA,
|
|
genomic RNA, precursor RNA, mRNA (cDNA), ribosomal RNA, transfer RNA,
|
|
small nuclear RNA, and small cytoplasmic RNA.</p>
|
|
|
|
|
|
<p>Entrez Search Field : Properties [PROP] Search Tip : Search term
|
|
should be in the format: biomol_genomic, biomol_mRNA, etc. For more
|
|
examples, view the Properties field in the Index mode.</p>
|
|
|
|
|
|
<h3 id="GenBankDivisionB"><a href="#GenBankDivisionA">GenBank Division</a></h3>
|
|
|
|
|
|
<p>The GenBank division to which a record belongs is indicated with a
|
|
three letter abbreviation. In this example, GenBank division is
|
|
<a href="#GenBankDivisionA">PLN</a>.</p>
|
|
|
|
|
|
<p>The GenBank database is divided into 18 divisions:</p>
|
|
|
|
|
|
<ol>
|
|
<li>PRI - primate sequences</li>
|
|
<li>ROD - rodent sequences</li>
|
|
<li>MAM - other mammalian sequences</li>
|
|
<li>VRT - other vertebrate sequences</li>
|
|
<li>INV - invertebrate sequences</li>
|
|
<li>PLN - plant, fungal, and algal sequences</li>
|
|
<li>BCT - bacterial sequences</li>
|
|
<li>VRL - viral sequences</li>
|
|
<li>PHG - bacteriophage sequences</li>
|
|
<li>SYN - synthetic sequences</li>
|
|
<li>UNA - unannotated sequences</li>
|
|
<li>EST - EST sequences (expressed sequence tags)</li>
|
|
<li>PAT - patent sequences</li>
|
|
<li>STS - STS sequences (sequence tagged sites)</li>
|
|
<li>GSS - GSS sequences (genome survey sequences)</li>
|
|
<li>HTG - HTG sequences (high-throughput genomic sequences)</li>
|
|
<li>HTC - unfinished high-throughput cDNA sequencing</li>
|
|
<li>ENV - environmental sampling sequences</li>
|
|
</ol>
|
|
|
|
|
|
<p>Some of the divisions contain sequences from specific groups of
|
|
organisms, whereas others (EST, GSS, HTG, etc.) contain data generated
|
|
by specific sequencing technologies from many different organisms. The
|
|
organismal divisions are historical and do not reflect the current
|
|
<a href="/taxonomy/">NCBI Taxonomy</a>. Instead, they merely serve as a
|
|
convenient way to divide GenBank into smaller pieces for those who
|
|
want to FTP the database. Because of this, and because sequences from
|
|
a particular organism can exist in technology-based divisions such as
|
|
EST, HTG, etc., the <a href="/taxonomy/">NCBI Taxonomy Browser</a> should be used
|
|
for retrieving all sequences from a particular organism.</p>
|
|
|
|
|
|
<p>Entrez Search Field : Properties [PROP] Search Tip : Search term
|
|
should be in the format: gbdiv_pri, gbdiv_est, etc. For more
|
|
examples, view the Properties field in the Index mode. For example, to
|
|
eliminate all sequences from a particular division, such as all ESTs,
|
|
you can use a Boolean query formatted such as: human[ORGN] NOT
|
|
gbdiv_est[PROP] For the reasons noted above, do not use GenBank
|
|
divisions to retrieve all sequences from a specific organism. Instead,
|
|
use the <a href="/Taxonomy/Browser/wwwtax.cgi">NCBI Taxonomy Browser</a>.</p>
|
|
|
|
|
|
<h3 id="ModificationDateB"><a href="#ModificationDateA">Modification Date</a></h3>
|
|
|
|
|
|
<p>The date in the LOCUS field is the date of last modification. The
|
|
sample record shown here was last modified on
|
|
<a href="#ModificationDateA">21-JUN-1999</a>.</p>
|
|
|
|
|
|
<p>Entrez Search Field : Modification Date [MDAT] Search Tips : (1)
|
|
Enter search term in the format: yyyy/mm/dd, e.g., 1999/07/25. (2) To
|
|
retrieve records modified between two dates, use the colon as a range
|
|
operator, e.g., 1999/07/25:1999/07/31[MDAT]. (3) You can use the
|
|
Publication Date [PDAT] field of Entrez to limit search results by
|
|
the date on which records were added to the Entrez system. Publication
|
|
date can be in the form of a range, just like the Modification Date.</p>
|
|
|
|
|
|
<h3 id="DefinitionB"><a href="#DefinitionA">DEFINITION</a></h3>
|
|
|
|
|
|
<p>Brief description of sequence; includes information such as source
|
|
organism, gene name/protein name, or some description of the
|
|
sequence's function (if the sequence is non-coding). If the sequence
|
|
has a coding region (CDS), description may be followed by a
|
|
completeness qualifier, such as "complete cds".</p>
|
|
|
|
|
|
<p>Entrez Search Field: Title Word [TITL] Search Tip : Although
|
|
nucleotide definition lines follow a
|
|
structured format,
|
|
GenBank does not use a controlled vocabulary, and authors determine
|
|
the content of their records. Therefore, if a search for a specific
|
|
term does not retrieve the desired records, try other terms that
|
|
authors might have used, such as synonyms, full spellings, or
|
|
abbreviations. The "related records" (or "neighbors") function of
|
|
Entrez also allows you to broaden your search by retrieving records
|
|
with similar sequences, regardless of the descriptive terms used by
|
|
the submitters.</p>
|
|
|
|
|
|
<h3 id="AccessionB"><a href="#AccessionA">ACCESSION</a></h3>
|
|
|
|
|
|
<p>The unique identifier for a sequence record. An accession number
|
|
applies to the complete record and is usually a combination of a
|
|
letter(s) and numbers, such as a single letter followed by five digits
|
|
(e.g., U12345) or two letters followed by six digits (e.g.,
|
|
AF123456). Some accessions might be longer, depending on the type of
|
|
sequence record.</p>
|
|
|
|
|
|
<p>Accession numbers do not change, even if information in the record is
|
|
changed at the author's request. Sometimes, however, an original
|
|
accession number might become secondary to a newer accession number,
|
|
if the authors make a new submission that combines previous sequences,
|
|
or if for some reason a new submission supercedes an earlier record.</p>
|
|
|
|
|
|
<p>Records from the <a href="/refseq/">RefSeq</a> database of reference sequences
|
|
have a their own <a href="//www.ncbi.nlm.nih.gov/books/NBK21091/table/ch18.T.refseq_accession_numbers_and_mole/?report=objectonly">accession number format</a>
|
|
that begins with two letters followed by an underscore bar and six or
|
|
more digits; for example:</p>
|
|
|
|
|
|
<pre><code>NT_123456 constructed genomic contigs
|
|
NM_123456 mRNAs
|
|
NP_123456 proteins
|
|
NC_123456 chromosomes
|
|
</code></pre>
|
|
|
|
|
|
<p><strong>Note:</strong> Most records have both a series of accession numbers
|
|
(<a href="#VersionB">Version</a> for nucleotide sequences and
|
|
<a href="#ProteinIDB">protein_id</a> for amino acid sequences) and sequence
|
|
identifiers (<a href="#GInB">GI</a> for nucleotide sequences and <a href="#GIpB">GI</a> for
|
|
amino acid sequences). See the online documentation for <a href="/genbank/sequenceids/">Sequence IDs</a> for details.</p>
|
|
|
|
|
|
<p>Entrez Search Field: Accession [ACCN] Search Tip : The letters in
|
|
the accession number can be written in upper- or lowercase. RefSeq
|
|
accessions must contain an underscore bar between the letters and the
|
|
numbers, e.g., NM_002111.</p>
|
|
|
|
|
|
<h3 id="VersionB"><a href="#VersionA">VERSION</a></h3>
|
|
|
|
|
|
<p>A nucleotide sequence identification number that represents a single,
|
|
specific sequence in the GenBank database. This identification number
|
|
uses the accession.version format implemented by GenBank/ENA/DDBJ in
|
|
February 1999.</p>
|
|
|
|
|
|
<p>If there is any change to the sequence data (even a single base), the
|
|
version number will be increased, e.g., U12345.1 ? U12345.2, but the
|
|
accession portion will remain stable.</p>
|
|
|
|
|
|
<p>The accession.version system of sequence identifiers runs parallel to
|
|
the <a href="#GInB">GI</a> number system--when any change is made to a sequence,
|
|
it receives a new GI number AND its version number is incremented by
|
|
one.</p>
|
|
|
|
|
|
<p>To find out about the revision history of a sequence, see
|
|
<a href="/genbank/sequencerevisionhistory/">GenBank Sequence Revision History</a>.</p>
|
|
|
|
|
|
<p>Entrez Search Field: use the default setting of "All Fields"</p>
|
|
|
|
|
|
<h3 id="GInB"><a href="#GInA">GI</a></h3>
|
|
|
|
|
|
<p>"GenInfo Identifier" sequence identification number, in this case, for
|
|
the nucleotide sequence. If a sequence changes in any way, a new GI
|
|
number will be assigned.</p>
|
|
|
|
|
|
<p>A separate GI number is also assigned to each protein translation
|
|
within a nucleotide sequence record, and a new GI is assigned if the
|
|
protein translation changes in any way (see <a href="#GIpB">below</a>).</p>
|
|
|
|
|
|
<p>GI sequence identifiers run parallel to the new accession.version
|
|
system of sequence identifiers.</p>
|
|
|
|
|
|
<p>Read more about <a href="/genbank/sequencerevisionhistory/">GenBank Sequence Revision History</a>
|
|
and <a href="/genbank/sequenceids/">Sequence IDs</a>.</p>
|
|
|
|
|
|
<p>Entrez Search Field: use the default setting of "All Fields"</p>
|
|
|
|
|
|
<h3 id="KeywordsB"><a href="#KeywordsA">KEYWORDS</a></h3>
|
|
|
|
|
|
<p>Word or phrase describing the sequence. If no keywords are included in
|
|
the entry, the field contains only a period.</p>
|
|
|
|
|
|
<p>The Keywords field is present in sequence records primarily for
|
|
historical reasons, and is not based on a controlled
|
|
vocabulary. Keywords are generally present in older records. They are
|
|
not included in newer records unless the record contains a special
|
|
type of sequence such as EST, STS, GSS, HTG, etc.</p>
|
|
|
|
|
|
<p>Entrez Search Field: Keyword [KYWD] Search Tip : Because keywords
|
|
are not present in many records, it is best not to search that
|
|
field. Instead, search All Fields [ALL], the Text Word [WORD]
|
|
field, or the Title Word [TITL] field, for progressively narrower
|
|
retrieval.</p>
|
|
|
|
|
|
<h3 id="SourceB"><a href="#SourceA">SOURCE</a></h3>
|
|
|
|
|
|
<p>Free-format information including an abbreviated form of the organism
|
|
name, sometimes followed by a molecule type.</p>
|
|
|
|
|
|
<p>Entrez Search Field: Organism [ORGN] Search Tip : For some organisms
|
|
that have well-established common names, such as baker's yeast, mouse,
|
|
and human, a search for the common name will yield the same results as
|
|
a search for the scientific name, e.g., a search for "baker's yeast"
|
|
in the organism field retrieves the same number of documents as
|
|
"Saccharomyces cerevisiae". This is true because the Organism field is
|
|
connected to the <a href="/taxonomy/">NCBI Taxonomy Database</a>, which contains
|
|
cross-references between common names, scientific names, and synonyms
|
|
for organisms represented in the Sequence databases.</p>
|
|
|
|
|
|
<h3 id="OrganismB"><a href="#OrganismA">Organism</a></h3>
|
|
|
|
|
|
<p>The formal scientific name for the source organism (genus and species,
|
|
where appropriate) and its lineage, based on the phylogenetic
|
|
classification scheme used in the <a href="/taxonomy/">NCBI Taxonomy Database</a>
|
|
. If the complete lineage of an organism is very long, an abbreviated
|
|
lineage will be shown in the GenBank record and the complete lineage
|
|
will be available in the Taxonomy Database. (See also the
|
|
<a href="#TaxonB">/db_xref=taxon:nnnn</a> Feature qualifer, below.)</p>
|
|
|
|
|
|
<p>Entrez Search Field: Organism [ORGN] Search Tip : You can search the
|
|
Organism field by any node in the taxonomic hierarchy, e.g., you can
|
|
search for the term "Saccharomyces cerevisiae", "Saccharomycetales",
|
|
"Ascomycota", etc. to retrieve all the sequences from organisms in a
|
|
particular taxon.</p>
|
|
|
|
|
|
<h3 id="ReferenceB"><a href="#ReferenceA">REFERENCE</a></h3>
|
|
|
|
|
|
<p>Publications by the authors of the sequence that discuss the data
|
|
reported in the record. References are automatically sorted within the
|
|
record based on date of publication, showing the oldest references
|
|
first.</p>
|
|
|
|
|
|
<p>Some sequences have not been reported in papers and show a status of
|
|
"unpublished" or "in press". When an accession number and/or sequence
|
|
data has appeared in print, sequence authors should send the complete
|
|
citation of the article to update@ncbi.nlm.nih.gov and the GenBank
|
|
staff will revise the record.</p>
|
|
|
|
|
|
<p>Various <a href="https://www.ncbi.nlm.nih.gov/Sequin/sequin.hlp.html#Class">classes</a>
|
|
of publication can be present in the References field, including
|
|
journal article, book chapter, book, thesis/monograph, proceedings
|
|
chapter, proceedings from a meeting, and patent.</p>
|
|
|
|
|
|
<p>The last citation in the REFERENCE field usually contains information
|
|
about the submitter of the sequence, rather than a literature
|
|
citation. It is therefore called the "submitter block" and shows the
|
|
words "Direct Submission" instead of an article title. Additional
|
|
information is provided below, under the header
|
|
<a href="#SubmitterBlockB">Direct Submission</a>. Some older records do not contain a
|
|
submitter block.</p>
|
|
|
|
|
|
<p>Entrez Search Field: The various subfields under References are
|
|
searchable in the Entrez search fields noted below.</p>
|
|
|
|
|
|
<h3 id="AuthorsB"><a href="#AuthorsA">AUTHORS</a></h3>
|
|
|
|
|
|
<p>List of authors in the order in which they appear in the cited
|
|
article.</p>
|
|
|
|
|
|
<p>Entrez Search Field: Author [AUTH] Search Tip : Enter author names
|
|
in the form: Lastname AB (without periods after the
|
|
initials). Initials can be omitted. Truncation can also be used to
|
|
retrieve all names that begin with a character string, e.g.,
|
|
Richards* or Boguski M*.</p>
|
|
|
|
|
|
<h3 id="TitleB"><a href="#TitleA">TITLE</a></h3>
|
|
|
|
|
|
<p>Title of the published work or tentative title of an unpublished work.</p>
|
|
|
|
|
|
<p>Sometimes the words "Direct Submission" instead of an article
|
|
title. This is usually true for the last citation in the
|
|
<a href="#ReferenceB">REFERENCE</a> field because it tends to contain information
|
|
about the submitter of the sequence, rather than a literature
|
|
citation. The last citation is therefore called the "submitter
|
|
block". Additional information is provided below, under the header
|
|
<a href="#SubmitterBlockB">Direct Submission</a>. Some older records do not
|
|
contain a submitter block.</p>
|
|
|
|
|
|
<p>Entrez Search Field: Text Word [WORD] Note: For sequence records,
|
|
the Title Word [TITL] field of Entrez searches the
|
|
<a href="#DefinitionB">Definition Line</a>, not the titles of references listed in the
|
|
record. Therefore, use the Text Word field to search the titles of
|
|
references (and other text-containing fields). Search Tip : If a
|
|
search for a specific term does not retrieve the desired records, try
|
|
other terms that authors might have used, such synonyms, full
|
|
spellings, or abbreviations. The 'related records' (or 'neighbors')
|
|
function of Entrez also allows you to broaden your search by
|
|
retrieving records with similar sequences, regardless of the
|
|
descriptive terms used by the submitters.</p>
|
|
|
|
|
|
<h3 id="JournalB"><a href="#JournalA">JOURNAL</a></h3>
|
|
|
|
|
|
<p>MEDLINE abbreviation of the journal name. (Full spellings can be obtained from the Entrez <a href="/journals/">Journals Database</a>.)</p>
|
|
|
|
|
|
<p>Entrez Search Field: Journal Name [JOUR] Search Tip : Journal names can be entered as either the full spelling or the MEDLINE abbreviation. You can search the Journal Name field in the Index mode to see the index for that field, and to select one or more journal names for inclusion in your search.</p>
|
|
|
|
|
|
<h3 id="PubMedB"><a href="#PubMedA">PUBMED</a></h3>
|
|
|
|
|
|
<p>PubMed Identifier (PMID).</p>
|
|
|
|
|
|
<p>References that include PubMed IDs contain links from the sequence
|
|
record to the corresponding PubMed record. Conversely, PubMed records
|
|
that contain accession number(s) in the SI (secondary source
|
|
identifier) field contain links back to the sequence record(s).</p>
|
|
|
|
|
|
<p>Entrez Search Field: It is not possible to search the Nucleotide or
|
|
Protein sequence databases by PubMed ID. However, you can search the
|
|
PubMed (literature) database of Entrez for the PubMed ID, and then
|
|
link to the associated sequence records.</p>
|
|
|
|
|
|
<h3 id="SubmitterBlockB"><a href="#SubmitterBlockA">Direct Submission</a></h3>
|
|
|
|
|
|
<p>Contact information of the submitter, such as institute/department and
|
|
postal address. This is always the last citation in the References
|
|
field. Some older records do not contain the "Direct Submission"
|
|
reference. However, it is required in all new records.</p>
|
|
|
|
|
|
<p>The Authors subfield contains the submitter name(s), Title contains
|
|
the words "Direct Submission", and Journal contains the address.</p>
|
|
|
|
|
|
<p>The date in the Journal subfield is the date on which the author
|
|
prepared the submission. In many cases, it is also the date on which
|
|
the sequence was received by the GenBank staff, but it is not the date
|
|
of first public release.</p>
|
|
|
|
|
|
<p>Entrez Search Field: Use the Author Field [AUTH] if searching for
|
|
the author name. Use All Fields [ALL] if searching for an element of
|
|
the author's address (e.g., Yale University). Note, however, that
|
|
retrieved records might contain the institution name in a field such
|
|
as Comment, rather than in the Direct Submission reference, so you
|
|
might get some false hits. Search Tip : It is sometimes helpful to
|
|
search for both the full spelling and an abbreviation, e.g.,
|
|
"Washington University" OR "WashU", because the spelling used by
|
|
authors might vary.</p>
|
|
|
|
|
|
<h3 id="FeaturesB"><a href="#FeaturesA">FEATURES</a></h3>
|
|
|
|
|
|
<p>Information about genes and gene products, as well as regions of
|
|
biological significance reported in the sequence. These can include
|
|
regions of the sequence that code for proteins and RNA molecules, as
|
|
well as a number of other features.</p>
|
|
|
|
|
|
<p>A complete list of features is available in the following places:</p>
|
|
|
|
|
|
<ul>
|
|
<li><a href="//www.insdc.org/documents/feature_table.html#7.3">Appendix III: Feature keys reference</a> of
|
|
the <a href="//www.insdc.org/documents/feature_table.html">DDBJ/EMBL/GenBank Feature Table</a> provides definitions,
|
|
optional qualifiers, and comments for each feature. An
|
|
<a href="//www.insdc.org/documents/feature_table.html#7.3.2">alphabetical list</a> is also
|
|
available. <a href="//www.insdc.org/documents/feature_table.html#7.4">Appendix IV: Summary of qualifiers for feature keys</a>
|
|
provides definitions for the Feature qualifiers.</li>
|
|
</ul>
|
|
|
|
|
|
<p>The location of each feature is provided as well, and can be a single
|
|
base, a contiguous span of bases, a joining of sequence spans, and
|
|
other representations. If a feature is located on the complementary
|
|
strand, the word "<a href="#ComplementA">complement</a>" will appear before the
|
|
base span. If the " <code><</code> " symbol precedes a base span, the sequence
|
|
is partial on the 5' end (e.g., <code>CDS <1..206</code>). If the "<code>></code>" symbol
|
|
follows a base span, the sequence is partial on the 3' end (e.g., <code>CDS
|
|
435..915></code>).</p>
|
|
|
|
|
|
<p>The sample record shown here only includes a small number of features
|
|
(source, CDS, and gene, all of which are described below). The
|
|
<a href="#OtherFeaturesB">Other Features</a> section, below, provides links to some
|
|
GenBank records that show a variety of additional features.</p>
|
|
|
|
|
|
<p>Entrez Search Field: Feature Key [FKEY] Search Tip : To scroll
|
|
through the list of available features, view the Feature Key field in
|
|
Index mode. You can then select one or more features from the index to
|
|
include in your query. For example, you can limit your search to
|
|
records that contain both primer_bind and promoter features.</p>
|
|
|
|
|
|
<h3 id="FeaturesSourceB"><a href="#FeaturesSourceA">source</a></h3>
|
|
|
|
|
|
<p>Mandatory feature in each record that summarizes the length of the
|
|
sequence, scientific name of the source organism, and Taxon ID
|
|
number. Can also include other information such as map location,
|
|
strain, clone, tissue type, etc., if provided by submitter.</p>
|
|
|
|
|
|
<p>Entrez Search Field: All Fields [ALL] can be used to search for some
|
|
elements in the source field, such as strain, clone, tissue type.</p>
|
|
|
|
|
|
<p>Use the <a href="#SequenceLengthB">Sequence Length</a> [SLEN] field to search
|
|
by length and the <a href="#OrganismB">Organism</a> [ORGN] field to search by
|
|
organism name.</p>
|
|
|
|
|
|
<p>Because map location is written as free text and can be represented in
|
|
a number of ways (e.g., chromosome number, cytogenetic location,
|
|
marker name, physical map location), it is not directly searchable in
|
|
the Entrez Nucleotide or Protein databases. However, there are a
|
|
number of resources that allow you to browse and/or search the
|
|
<a href="/guide/genomes-maps/">maps of various genomes</a>.</p>
|
|
|
|
|
|
<h3 id="TaxonB"><a href="#TaxonA">Taxon</a></h3>
|
|
|
|
|
|
<p>A stable unique identification number for the taxon of the source
|
|
oganism. A taxonomy ID number is assigned to each taxon (species,
|
|
genus, family, etc.) in the <a href="/taxonomy/">NCBI Taxonomy Database</a>. See
|
|
also the <a href="#OrganismB">Organism</a> field, above.</p>
|
|
|
|
|
|
<p>Entrez Search Field: The Taxonomy ID number is not searchable in the
|
|
Organism search field of Entrez but is searchable in the <a href="/taxonomy/">Taxonomy Browser</a>.</p>
|
|
|
|
|
|
<p>Note: The <a href="#TaxonA">/db_xref qualifier</a> is one of many that can be
|
|
applied to various features. A complete list is available in
|
|
<a href="//www.insdc.org/documents/feature_table.html#7.4">Appendix IV: Summary of qualifiers for feature keys</a> of the
|
|
<a href="//www.insdc.org/documents/feature_table.html">DDBJ/EMBL/GenBank Feature Table</a>, and in section
|
|
3.4.12.3 of the GenBank <a href="https://ftp.ncbi.nih.gov/genbank/gbrel.txt">release notes</a>.
|
|
<a href="/projects/collab/FT/index#7.3">Appendix III: Feature keys reference</a> shows which
|
|
qualifiers can be used with specific
|
|
features (see <a href="//www.insdc.org/documents/feature_table.html#7.3.2">alphabetical list</a>).</p>
|
|
|
|
|
|
<h3 id="CDSB"><a href="#CDSA">CDS</a></h3>
|
|
|
|
|
|
<p>Coding sequence; region of nucleotides that corresponds with the
|
|
sequence of amino acids in a protein (location includes start and stop
|
|
codons). The CDS feature includes an amino acid
|
|
<a href="#TranslationB">translation</a>. Authors can specify the nature of the
|
|
CDS by using the qualifier "/evidence=experimental" or
|
|
"/evidence=not_experimental".</p>
|
|
|
|
|
|
<p>Submitters are also encouraged to annotate the mRNA feature, which
|
|
includes the 5' untranslated region (5'UTR), coding sequences (CDS,
|
|
exon), and 3' untranslated region (3'UTR).</p>
|
|
|
|
|
|
<p>Entrez Search Field: Feature Key [FKEY] Search Tip : You can use
|
|
this field to limit your search to records that contain a particular
|
|
feature, such as CDS. To scroll through the list of available
|
|
features, view the Feature Key field in Index mode. A complete list of
|
|
features is also available from the resources noted
|
|
<a href="#FeaturesB">above</a>.</p>
|
|
|
|
|
|
<h3 id="BaseSpanB"><a href="#BaseSpanA"><1..206</a></h3>
|
|
|
|
|
|
<p>Base span of the biological feature indicated to the left, in this
|
|
case, a CDS feature. (The CDS feature is described <a href="#CDSB">above</a>,
|
|
and its base span includes the start and stop codons.) Features can be
|
|
complete, partial on the 5' end, partial on the 3' end, and/or on the
|
|
complementary strand. Examples:</p>
|
|
|
|
|
|
<ol>
|
|
<li>
|
|
<p>A complete feature is simply written as n..m. Example: <code>687..3158</code> The feature extends from base 687 through base 3158 in the sequence shown</p>
|
|
</li>
|
|
<li>
|
|
<p>The <code><</code> symbol indicates partial on the 5' end. Example: <code><1..206</code>.
|
|
The feature extends from base 1 through base 206 in the sequence
|
|
shown, and is partial on the 5' end</p>
|
|
</li>
|
|
<li>
|
|
<p>The <code>></code> symbol indicates partial on the 3' end. Example:
|
|
<code>4821..>5028</code>. The feature extends from base 4821 through base 5028
|
|
and is partial on the 3' end.</p>
|
|
</li>
|
|
<li>
|
|
<p><code>complement(range)</code> indicates that the feature is on the
|
|
complementary strand. Example: <code>complement(3300..4037)</code>. The feature
|
|
extends from base 3300 through base 4037 but is actually on the
|
|
complementary strand. It is therefore read in the opposite direction
|
|
on the reverse complement sequence. (For an example, see
|
|
<a href="#ComplementA">the third CDS feature</a> in the sample record shown on this page. In
|
|
this case, the amino acid translation is generated by taking the
|
|
reverse complement of bases 3300 to 4037 and reading that reverse
|
|
complement sequence in its 5' to 3' direction.)</p>
|
|
</li>
|
|
</ol>
|
|
|
|
|
|
<h3 id="ProteinIDB"><a href="#ProteinIDA">protein_id</a></h3>
|
|
|
|
|
|
<p>A protein sequence identification number, similar to the
|
|
<a href="#VersionB">Version</a> number of a nucleotide sequence. Protein IDs
|
|
consist of three letters followed by five digits, a dot, and a version
|
|
number. If there is any change to the sequence data (even a single
|
|
amino acid), the version number will be increased, but the accession
|
|
portion will remain stable (e.g., AAA98665.1 will change to
|
|
AAA98665.2).</p>
|
|
|
|
|
|
<p>The accession.version format of protein sequence identification
|
|
numbers was implemented by GenBank/ENA/DDBJ in February 1999 and runs
|
|
parallel to the GI number system. More details about sequence
|
|
identification numbers and the difference between GI number and
|
|
version are provided in <a href="/genbank/sequenceids/">Sequence Identifiers: A Historical Note</a>.</p>
|
|
|
|
|
|
<p>Entrez Search Field: use the default setting of "All Fields"</p>
|
|
|
|
|
|
<h3 id="GIpB"><a href="#GIpA">GI</a></h3>
|
|
|
|
|
|
<p>"GenInfo Identifier" sequence identification number, in this case, for
|
|
the protein translation.</p>
|
|
|
|
|
|
<p>The GI system of sequence identifiers runs parallel to the
|
|
accession.version system, which was implemented by GenBank, EMBL, and
|
|
DDBJ in February 1999. Therefore, if the protein sequence changes in
|
|
any way, it will receive a new GI number, and the suffix of the
|
|
<a href="#ProteinIDB">protein_id</a> will be incremented by one..</p>
|
|
|
|
|
|
<p>More details about sequence identification numbers and the difference
|
|
between GI number and version are provided in <a href="/genbank/sequenceids/">Sequence IDs</a>.</p>
|
|
|
|
|
|
<p>Entrez Search Field: use the default setting of "All Fields"</p>
|
|
|
|
|
|
<h3 id="TranslationB"><a href="#TranslationA">translation</a></h3>
|
|
|
|
|
|
<p>The amino acid translation corresponding to the nucleotide coding
|
|
sequence (<a href="#CDSB">CDS</a>). In many cases, the translations are
|
|
conceptual. Note that authors can indicate whether the CDS is based on
|
|
experimental or non-experimental evidence.</p>
|
|
|
|
|
|
<p>Entrez Search Field: It is not possible to search the translation
|
|
subfield using Entrez. If you want use a string of amino acids as a
|
|
query to retrieve similar protein sequences, use <a href="/blast/">BLAST</a>
|
|
instead.</p>
|
|
|
|
|
|
<h3 id="GeneB"><a href="#GeneA">gene</a></h3>
|
|
|
|
|
|
<p>A region of biological interest identified as a gene and for which a
|
|
name has been assigned. The base span for the gene feature is
|
|
dependent on the furthest 5' and 3' features. Additional examples of
|
|
records that show the relationship between gene features and other
|
|
features such as mRNA and CDS are
|
|
<a href="/nuccore/AF165912?report=graph">AF165912</a> and
|
|
<a href="/nuccore/AF090832?report=graph">AF090832</a>.</p>
|
|
|
|
|
|
<p>Entrez Search Field: Feature Key [FKEY] Search Tip : You can use
|
|
this field to limit your search to records that contain a particular
|
|
feature, such as a gene. To scroll through the list of available
|
|
features, view the Feature Key field in Index mode. A complete list of
|
|
features is also available from the resources noted
|
|
<a href="#FeaturesB">above</a>.</p>
|
|
|
|
|
|
<h3 id="ComplementB"><a href="#ComplementA">complement</a></h3>
|
|
|
|
|
|
<p>Indicates that the feature is located on the complementary strand.</p>
|
|
|
|
|
|
<h3 id="OtherFeaturesB">Other Features</h3>
|
|
|
|
|
|
<p>Examples of other records that show a variety of biological features;
|
|
a graphic format is also available for each sequence record and
|
|
visually represents the annotated features:</p>
|
|
|
|
|
|
<ul>
|
|
<li><a href="/nucleotide/AF165912">AF165912 (gene, promoter, TATA signal, mRNA, 5'UTR, CDS, 3'UTR)</a></li>
|
|
<li><a href="/nucleotide/AF090832">AF090832</a> (protein bind, gene, 5'UTR, mRNA, CDS, 3'UTR)</li>
|
|
<li><a href="/nucleotide/L00727">L00727</a> (alternatively spliced mRNAs)</li>
|
|
</ul>
|
|
|
|
|
|
<p>A complete list of features is available from the resources noted <a href="#FeaturesB">above</a>.</p>
|
|
|
|
|
|
<h3 id="OriginB"><a href="#OriginA">ORIGIN</a></h3>
|
|
|
|
|
|
<p>The ORIGIN may be left blank, may appear as "Unreported," or may give
|
|
a local pointer to the sequence start, usually involving an
|
|
experimentally determined restriction cleavage site or the genetic
|
|
locus (if available). This information is present only in older
|
|
records.</p>
|
|
|
|
|
|
<p>The sequence data begin on the line immediately below ORIGIN. To view
|
|
or download the sequence data in <a href="/blast/blastcgihelp.shtml">FASTA format</a>, append <code>?format=fasta</code> to the
|
|
record's URL; for example,
|
|
<a href="/nucleotide/U49845?format=fasta&report=text">/nucleotide/U49845?format=fasta&report=text</a>.</p>
|
|
|
|
|
|
</div>
|
|
<!--/.col1-->
|
|
<div class="col2">
|
|
<div class="rightnav">
|
|
<h2 id="genbank-resources">GenBank Resources</h2>
|
|
<ul>
|
|
<li><a href="/genbank/">GenBank Home</a></li>
|
|
<li><a href="/genbank/submit_types">Submission Types</a></li>
|
|
<li><a href="/genbank/submit">Submission Tools</a></li>
|
|
<li><a href="https://www.ncbi.nlm.nih.gov/nuccore/">Search GenBank</a></li>
|
|
<li><a href="/genbank/update">Update GenBank Records</a></li>
|
|
</ul>
|
|
</div>
|
|
</div>
|
|
<!--/.col2-->
|
|
<div class="col3">
|
|
|
|
</div>
|
|
<!--/.col3-->
|
|
<div class="col4">
|
|
|
|
</div>
|
|
<!--/.col4-->
|
|
<div class="col5">
|
|
|
|
</div>
|
|
<div class="col6">
|
|
|
|
</div>
|
|
<div class="col7">
|
|
|
|
</div>
|
|
<div class="col8">
|
|
|
|
</div>
|
|
<div class="col9">
|
|
|
|
</div>
|
|
</div><!--/.content-->
|
|
</div><!--/.container-->
|
|
<div id="NCBIFooter_dynamic">
|
|
<div class="breadcrumbs">You are here:
|
|
<span id="breadcrumb_text"><a href="/guide/">NCBI</a></span></div>
|
|
<a id="help-desk-link" class="help_desk" href="https://support.ncbi.nlm.nih.gov/ics/support/default.asp?Time=2025-03-05T03:08:28-05:00&Snapshot=%2Fprojects%2Fstaticsites%2Fgenbank%2Fgenbank@2.21&Host=portal104&ncbi_phid=CE8B66A37C7F43C100000000011C00E4&ncbi_session=CE8B5AF87C7FFCB1_0191SID&from=https%3A%2F%2Fwww.ncbi.nlm.nih.gov%2Fgenbank%2Fsamplerecord%2F&Ncbi_App=genbank&Page=custom-page&style=classic&deptID=28049" target="_blank">Support Center</a>
|
|
<noscript><img alt="" src="/stat?jsdisabled=true&ncbi_app=genbank&ncbi_db=&ncbi_pdid=custom-page&ncbi_phid=CE8B66A37C7F43C100000000011C00E4" /></noscript>
|
|
</div>
|
|
|
|
|
|
<div xmlns:xi="http://www.w3.org/2001/XInclude">
|
|
<div xmlns="http://www.w3.org/1999/xhtml" class="footer" id="footer" xml:base="http://127.0.0.1/sites/static/header_footer">
|
|
<section class="icon-section">
|
|
<div id="icon-section-header" class="icon-section_header">Follow NCBI</div>
|
|
<div class="grid-container container">
|
|
<div class="icon-section_container">
|
|
<a class="footer-icon" id="footer_twitter" href="https://twitter.com/ncbi" aria-label="Twitter">
|
|
<svg xmlns="http://www.w3.org/2000/svg" width="40" height="40" viewBox="0 0 40 40" fill="none">
|
|
<title>Twitter</title>
|
|
<g id="twitterx1008">
|
|
<path id="path1008" d="M6.06736 7L16.8778 20.8991L6.00001 32.2H10.2L18.6 23.1L25.668 32.2H34L22.8 17.5L31.9 7H28.4L20.7 15.4L14.401 7H6.06898H6.06736ZM9.66753 8.73423H12.9327L29.7327 30.4658H26.5697L9.66753 8.73423Z" fill="#5B616B"></path>
|
|
</g>
|
|
</svg>
|
|
</a>
|
|
<a class="footer-icon" id="footer_facebook" href="https://www.facebook.com/ncbi.nlm" aria-label="Facebook"><svg xmlns="http://www.w3.org/2000/svg" data-name="Layer 1" viewBox="0 0 300 300">
|
|
<title>Facebook</title>
|
|
<path class="cls-11" d="M210.5,115.12H171.74V97.82c0-8.14,5.39-10,9.19-10h27.14V52l-39.32-.12c-35.66,0-42.42,26.68-42.42,43.77v19.48H99.09v36.32h27.24v109h45.41v-109h35Z">
|
|
</path>
|
|
</svg></a>
|
|
<a class="footer-icon" id="footer_linkedin" href="https://www.linkedin.com/company/ncbinlm" aria-label="LinkedIn"><svg xmlns="http://www.w3.org/2000/svg" data-name="Layer 1" viewBox="0 0 300 300">
|
|
<title>LinkedIn</title>
|
|
<path class="cls-11" d="M101.64,243.37H57.79v-114h43.85Zm-22-131.54h-.26c-13.25,0-21.82-10.36-21.82-21.76,0-11.65,8.84-21.15,22.33-21.15S101.7,78.72,102,90.38C102,101.77,93.4,111.83,79.63,111.83Zm100.93,52.61A17.54,17.54,0,0,0,163,182v61.39H119.18s.51-105.23,0-114H163v13a54.33,54.33,0,0,1,34.54-12.66c26,0,44.39,18.8,44.39,55.29v58.35H198.1V182A17.54,17.54,0,0,0,180.56,164.44Z">
|
|
</path>
|
|
</svg></a>
|
|
<a class="footer-icon" id="footer_github" href="https://github.com/ncbi" aria-label="GitHub"><svg xmlns="http://www.w3.org/2000/svg" data-name="Layer 1" viewBox="0 0 300 300">
|
|
<defs>
|
|
<style>
|
|
.cls-11,
|
|
.cls-12 {
|
|
fill: #737373;
|
|
}
|
|
|
|
.cls-11 {
|
|
fill-rule: evenodd;
|
|
}
|
|
</style>
|
|
</defs>
|
|
<title>GitHub</title>
|
|
<path class="cls-11" d="M151.36,47.28a105.76,105.76,0,0,0-33.43,206.1c5.28,1,7.22-2.3,7.22-5.09,0-2.52-.09-10.85-.14-19.69-29.42,6.4-35.63-12.48-35.63-12.48-4.81-12.22-11.74-15.47-11.74-15.47-9.59-6.56.73-6.43.73-6.43,10.61.75,16.21,10.9,16.21,10.9,9.43,16.17,24.73,11.49,30.77,8.79,1-6.83,3.69-11.5,6.71-14.14C108.57,197.1,83.88,188,83.88,147.51a40.92,40.92,0,0,1,10.9-28.39c-1.1-2.66-4.72-13.42,1-28,0,0,8.88-2.84,29.09,10.84a100.26,100.26,0,0,1,53,0C198,88.3,206.9,91.14,206.9,91.14c5.76,14.56,2.14,25.32,1,28a40.87,40.87,0,0,1,10.89,28.39c0,40.62-24.74,49.56-48.29,52.18,3.79,3.28,7.17,9.71,7.17,19.58,0,14.15-.12,25.54-.12,29,0,2.82,1.9,6.11,7.26,5.07A105.76,105.76,0,0,0,151.36,47.28Z">
|
|
</path>
|
|
<path class="cls-12" d="M85.66,199.12c-.23.52-1.06.68-1.81.32s-1.2-1.06-.95-1.59,1.06-.69,1.82-.33,1.21,1.07.94,1.6Zm-1.3-1">
|
|
</path>
|
|
<path class="cls-12" d="M90,203.89c-.51.47-1.49.25-2.16-.49a1.61,1.61,0,0,1-.31-2.19c.52-.47,1.47-.25,2.17.49s.82,1.72.3,2.19Zm-1-1.08">
|
|
</path>
|
|
<path class="cls-12" d="M94.12,210c-.65.46-1.71,0-2.37-.91s-.64-2.07,0-2.52,1.7,0,2.36.89.65,2.08,0,2.54Zm0,0"></path>
|
|
<path class="cls-12" d="M99.83,215.87c-.58.64-1.82.47-2.72-.41s-1.18-2.06-.6-2.7,1.83-.46,2.74.41,1.2,2.07.58,2.7Zm0,0">
|
|
</path>
|
|
<path class="cls-12" d="M107.71,219.29c-.26.82-1.45,1.2-2.64.85s-2-1.34-1.74-2.17,1.44-1.23,2.65-.85,2,1.32,1.73,2.17Zm0,0">
|
|
</path>
|
|
<path class="cls-12" d="M116.36,219.92c0,.87-1,1.59-2.24,1.61s-2.29-.68-2.3-1.54,1-1.59,2.26-1.61,2.28.67,2.28,1.54Zm0,0">
|
|
</path>
|
|
<path class="cls-12" d="M124.42,218.55c.15.85-.73,1.72-2,1.95s-2.37-.3-2.52-1.14.73-1.75,2-2,2.37.29,2.53,1.16Zm0,0"></path>
|
|
</svg></a>
|
|
<a class="footer-icon" id="footer_blog" href="https://ncbiinsights.ncbi.nlm.nih.gov/" aria-label="Blog">
|
|
<svg xmlns="http://www.w3.org/2000/svg" id="Layer_1" data-name="Layer 1" viewBox="0 0 40 40">
|
|
<defs><style>.cls-1{fill:#737373;}</style></defs>
|
|
<title>NCBI Insights Blog</title>
|
|
<path class="cls-1" d="M14,30a4,4,0,1,1-4-4,4,4,0,0,1,4,4Zm11,3A19,19,0,0,0,7.05,15a1,1,0,0,0-1,1v3a1,1,0,0,0,.93,1A14,14,0,0,1,20,33.07,1,1,0,0,0,21,34h3a1,1,0,0,0,1-1Zm9,0A28,28,0,0,0,7,6,1,1,0,0,0,6,7v3a1,1,0,0,0,1,1A23,23,0,0,1,29,33a1,1,0,0,0,1,1h3A1,1,0,0,0,34,33Z"></path>
|
|
</svg>
|
|
</a>
|
|
</div>
|
|
</div>
|
|
</section>
|
|
|
|
<section class="container-fluid bg-primary">
|
|
<div class="container pt-5">
|
|
<div class="row mt-3">
|
|
<div class="col-lg-3 col-12">
|
|
<p><a class="text-white" href="https://www.nlm.nih.gov/socialmedia/index.html">Connect with NLM</a></p>
|
|
<ul class="list-inline social_media">
|
|
<li class="list-inline-item"><a href="https://twitter.com/NLM_NIH" aria-label="Twitter" target="_blank" rel="noopener noreferrer">
|
|
<svg xmlns="http://www.w3.org/2000/svg" width="35" height="35" viewBox="0 0 36 35" fill="none">
|
|
<title>Twitter</title>
|
|
<g id="twitterx1009" clip-path="url(#clip0_65276_3946)">
|
|
<path id="Vector_Twitter" d="M17.5006 34.6565C26.9761 34.6565 34.6575 26.9751 34.6575 17.4996C34.6575 8.02416 26.9761 0.342773 17.5006 0.342773C8.02514 0.342773 0.34375 8.02416 0.34375 17.4996C0.34375 26.9751 8.02514 34.6565 17.5006 34.6565Z" fill="#205493" stroke="white" stroke-width="1.0" stroke-miterlimit="10"></path>
|
|
<path id="path1009" d="M8.54811 8.5L16.2698 18.4279L8.50001 26.5H11.5L17.5 20L22.5486 26.5H28.5L20.5 16L27 8.5H24.5L19 14.5L14.5007 8.5H8.54927H8.54811ZM11.1197 9.73873H13.4519L25.4519 25.2613H23.1926L11.1197 9.73873Z" fill="white"></path>
|
|
</g>
|
|
<defs>
|
|
<clipPath id="clip0_65276_3946">
|
|
<rect width="35" height="35" fill="white"></rect>
|
|
</clipPath>
|
|
</defs>
|
|
</svg>
|
|
</a></li>
|
|
<li class="list-inline-item"><a href="https://www.facebook.com/nationallibraryofmedicine" aria-label="Facebook" rel="noopener noreferrer" target="_blank">
|
|
<svg xmlns="http://www.w3.org/2000/svg" width="35" height="35" viewBox="0 0 36 35" fill="none">
|
|
<title>Facebook</title>
|
|
<g id="Facebook" clip-path="url(#clip0_1717_1086)">
|
|
<path id="Vector_Facebook" d="M15.1147 29.1371C15.1147 29.0822 15.1147 29.0296 15.1147 28.9747V18.9414H11.8183C11.6719 18.9414 11.6719 18.9414 11.6719 18.8018C11.6719 17.5642 11.6719 16.3289 11.6719 15.0937C11.6719 14.9793 11.7062 14.9518 11.816 14.9518C12.8683 14.9518 13.9206 14.9518 14.9751 14.9518H15.1215V14.8329C15.1215 13.8057 15.1215 12.774 15.1215 11.7492C15.1274 10.9262 15.3148 10.1146 15.6706 9.37241C16.1301 8.38271 16.9475 7.60378 17.9582 7.19235C18.6492 6.90525 19.3923 6.76428 20.1405 6.7783C21.0029 6.79202 21.8653 6.83091 22.7278 6.86065C22.8879 6.86065 23.048 6.89496 23.2082 6.90182C23.2974 6.90182 23.3271 6.94071 23.3271 7.02993C23.3271 7.54235 23.3271 8.05477 23.3271 8.5649C23.3271 9.16882 23.3271 9.77274 23.3271 10.3767C23.3271 10.4819 23.2974 10.5139 23.1921 10.5116C22.5379 10.5116 21.8814 10.5116 21.2271 10.5116C20.9287 10.5184 20.6316 10.5528 20.3395 10.6146C20.0822 10.6619 19.8463 10.7891 19.6653 10.9779C19.4842 11.1668 19.3672 11.4078 19.3307 11.6669C19.2857 11.893 19.2612 12.1226 19.2575 12.3531C19.2575 13.1904 19.2575 14.0299 19.2575 14.8695C19.2575 14.8946 19.2575 14.9198 19.2575 14.9564H23.0229C23.1807 14.9564 23.183 14.9564 23.1624 15.1074C23.0778 15.7662 22.9885 16.425 22.9039 17.0816C22.8322 17.6321 22.7636 18.1827 22.698 18.7332C22.6729 18.9437 22.6797 18.9437 22.4693 18.9437H19.2644V28.8992C19.2644 28.9793 19.2644 29.0593 19.2644 29.1394L15.1147 29.1371Z" fill="white"></path>
|
|
<path id="Vector_2_Facebook" d="M17.5006 34.657C26.9761 34.657 34.6575 26.9756 34.6575 17.5001C34.6575 8.02465 26.9761 0.343262 17.5006 0.343262C8.02514 0.343262 0.34375 8.02465 0.34375 17.5001C0.34375 26.9756 8.02514 34.657 17.5006 34.657Z" stroke="white" stroke-width="1.0" stroke-miterlimit="10"></path>
|
|
</g>
|
|
<defs>
|
|
<clipPath id="clip0_1717_1086">
|
|
<rect width="35" height="35" fill="white"></rect>
|
|
</clipPath>
|
|
</defs>
|
|
</svg>
|
|
</a></li>
|
|
<li class="list-inline-item"><a href="https://www.youtube.com/user/NLMNIH" aria-label="Youtube" target="_blank" rel="noopener noreferrer">
|
|
<svg xmlns="http://www.w3.org/2000/svg" width="35" height="35" viewBox="0 0 36 35" fill="none">
|
|
<title>Youtube</title>
|
|
<g id="YouTube" clip-path="url(#clip0_1717_1101)">
|
|
<path id="Vector_Youtube" d="M26.2571 11.4791C25.9025 11.1589 25.5709 10.9576 24.228 10.834C22.5512 10.6785 20.2797 10.6556 18.564 10.6533H16.4365C14.7208 10.6533 12.4493 10.6785 10.7725 10.834C9.43196 10.9576 9.09798 11.1589 8.7434 11.4791C7.81464 12.321 7.6202 14.6268 7.59961 16.8938C7.59961 17.3178 7.59961 17.741 7.59961 18.1635C7.62706 20.4121 7.82837 22.686 8.7434 23.521C9.09798 23.8412 9.42967 24.0425 10.7725 24.1661C12.4493 24.3216 14.7208 24.3445 16.4365 24.3468H18.564C20.2797 24.3468 22.5512 24.3216 24.228 24.1661C25.5686 24.0425 25.9025 23.8412 26.2571 23.521C27.1722 22.6929 27.3735 20.451 27.4009 18.2206C27.4009 17.7402 27.4009 17.2599 27.4009 16.7795C27.3735 14.5491 27.1699 12.3072 26.2571 11.4791ZM15.5604 20.5311V14.652L20.561 17.5001L15.5604 20.5311Z" fill="white"></path>
|
|
<path id="Vector_2_Youtube" d="M17.5006 34.657C26.9761 34.657 34.6575 26.9756 34.6575 17.5001C34.6575 8.02465 26.9761 0.343262 17.5006 0.343262C8.02514 0.343262 0.34375 8.02465 0.34375 17.5001C0.34375 26.9756 8.02514 34.657 17.5006 34.657Z" stroke="white" stroke-width="1.0" stroke-miterlimit="10"></path>
|
|
</g>
|
|
<defs>
|
|
<clipPath id="clip0_1717_1101">
|
|
<rect width="35" height="35" fill="white"></rect>
|
|
</clipPath>
|
|
</defs>
|
|
</svg>
|
|
</a></li>
|
|
</ul>
|
|
</div>
|
|
<div class="col-lg-3 col-12">
|
|
<p class="address_footer text-white">National Library of Medicine<br />
|
|
<a href="https://www.google.com/maps/place/8600+Rockville+Pike,+Bethesda,+MD+20894/@38.9959508,-77.101021,17z/data=!3m1!4b1!4m5!3m4!1s0x89b7c95e25765ddb:0x19156f88b27635b8!8m2!3d38.9959508!4d-77.0988323" class="text-white" target="_blank" rel="noopener noreferrer">8600 Rockville Pike<br />
|
|
Bethesda, MD 20894</a></p>
|
|
</div>
|
|
<div class="col-lg-3 col-12 centered-lg">
|
|
<p><a href="https://www.nlm.nih.gov/web_policies.html" class="text-white">Web Policies</a><br />
|
|
<a href="https://www.nih.gov/institutes-nih/nih-office-director/office-communications-public-liaison/freedom-information-act-office" class="text-white">FOIA</a><br />
|
|
<a href="https://www.hhs.gov/vulnerability-disclosure-policy/index.html" class="text-white" id="vdp">HHS Vulnerability Disclosure</a></p>
|
|
</div>
|
|
<div class="col-lg-3 col-12 centered-lg">
|
|
<p><a class="supportLink text-white" href="https://support.nlm.nih.gov/">Help</a><br />
|
|
<a href="https://www.nlm.nih.gov/accessibility.html" class="text-white">Accessibility</a><br />
|
|
<a href="https://www.nlm.nih.gov/careers/careers.html" class="text-white">Careers</a></p>
|
|
</div>
|
|
</div>
|
|
<div class="row">
|
|
<div class="col-lg-12 centered-lg">
|
|
<nav class="bottom-links">
|
|
<ul class="mt-3">
|
|
<li>
|
|
<a class="text-white" href="//www.nlm.nih.gov/">NLM</a>
|
|
</li>
|
|
<li>
|
|
<a class="text-white" href="https://www.nih.gov/">NIH</a>
|
|
</li>
|
|
<li>
|
|
<a class="text-white" href="https://www.hhs.gov/">HHS</a>
|
|
</li>
|
|
<li>
|
|
<a class="text-white" href="https://www.usa.gov/">USA.gov</a>
|
|
</li>
|
|
</ul>
|
|
</nav>
|
|
</div>
|
|
</div>
|
|
</div>
|
|
</section>
|
|
<script type="text/javascript" src="/portal/portal3rc.fcgi/rlib/js/InstrumentOmnitureBaseJS/InstrumentNCBIConfigJS/InstrumentNCBIBaseJS/InstrumentPageStarterJS.js?v=1"> </script>
|
|
<script type="text/javascript" src="/portal/portal3rc.fcgi/static/js/hfjs2.js"> </script>
|
|
</div>
|
|
</div>
|
|
<!--/.footer-->
|
|
<p class="last-updated small">Last updated: 2021-01-12T17:59:15Z</p>
|
|
</div>
|
|
<!--/.page-->
|
|
</div>
|
|
<!--/.wrap-->
|
|
<span class="PAFAppResources"></span>
|
|
|
|
|
|
</div><!-- /.twelve_col -->
|
|
</div>
|
|
<!-- /.grid -->
|
|
|
|
|
|
|
|
<!-- usually for JS scripts at page bottom -->
|
|
<span class="pagefixtures"></span>
|
|
|
|
|
|
<!-- CE8B5AF87C7FFCB1_0191SID /projects/staticsites/genbank/genbank@2.21 portal104 v4.1.r689238 Tue, Oct 22 2024 16:10:51 -->
|
|
<span id="portal-csrf-token" style="display:none" data-token="CE8B5AF87C7FFCB1_0191SID"></span>
|
|
|
|
<script type="text/javascript" src="//static.pubmed.gov/portal/portal3rc.fcgi/4218137/js/3879255/4121861/1490097/4087685.js" snapshot="genbank"></script></body>
|
|
</html>
|
|
|