publicdata/nih-gov
1
0
Fork 0
Code Issues Pull requests Projects Releases Packages Wiki Activity Actions
nih-gov/www.ncbi.nlm.nih.gov/genbank/release/current/index.html

20000 lines
864 KiB
HTML
Raw Permalink Blame History

<?xml version="1.0" encoding="utf-8"?>
<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd">
<html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en">
<head><meta http-equiv="Content-Type" content="text/html; charset=utf-8" />
<!-- AppResources meta begin -->
<meta name="paf-app-resources" content="" />
<!-- AppResources meta end -->
<!-- TemplateResources meta begin -->
<meta name="paf_template" content="StdNCol" />
<!-- TemplateResources meta end -->
<!-- Page meta begin -->
<!-- Page meta end -->
<!-- Logger begin -->
<meta xmlns:ncbi-portal="http://ncbi.gov/portal/XSLT/namespace" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" name="ncbi_app" content="genbank" /><meta xmlns:ncbi-portal="http://ncbi.gov/portal/XSLT/namespace" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" name="ncbi_pdid" content="static" />
<!-- Logger end -->
<title>Current GenBank Release Notes</title>
<!-- PageFixtures headcontent begin -->
<meta name="cms-local-nav-url" content="https://cms.ncbi.nlm.nih.gov//genbank/_nav" />
<!-- PageFixtures headcontent end -->
<!-- AppResources external_resources begin -->
<script type="text/javascript" src="/core/jig/1.15.6/js/jig.min.js"></script>
<!-- AppResources external_resources end -->
<!-- Page headcontent begin -->
<style type="text/css">pre { font-size: 1.3em; }</style>
<!-- Page headcontent end -->
<!-- PageFixtures resources begin -->
<link xmlns="http://www.w3.org/1999/xhtml" type="text/css" rel="stylesheet" href="//static.pubmed.gov/portal/portal3rc.fcgi/4218191/css/4207974/4206132.css" xml:base="http://127.0.0.1/sites/static/header_footer" />
<!-- PageFixtures resources end -->
<link rel="shortcut icon" href="//www.ncbi.nlm.nih.gov/favicon.ico" /><meta name="ncbi_phid" content="CE8E7A9A7DA027910000000000B900A0.m_6" />
<meta name='referrer' content='origin-when-cross-origin'/><link type="text/css" rel="stylesheet" href="//static.pubmed.gov/portal/portal3rc.fcgi/4218137/css/4121862/3974050/3917732/251717/4108189/14534/45193/3534283/4128070/4005757/4062871.css" /><link type="text/css" rel="stylesheet" href="//static.pubmed.gov/portal/portal3rc.fcgi/4218137/css/3529741/3529739.css" media="print" /></head>
<body class=" static">
<div class="grid">
<div class="col twelve_col nomargin shadow">
<!-- System messages like service outage or JS required; this is handled by the TemplateResources portlet -->
<div class="sysmessages">
<noscript>
<p class="nojs">
<strong>Warning:</strong>
The NCBI web site requires JavaScript to function.
<a href="/guide/browsers/#enablejs" title="Learn how to enable JavaScript" target="_blank">more...</a>
</p>
</noscript>
</div>
<!--/.sysmessage-->
<div class="wrap">
<div class="page">
<div xmlns:xi="http://www.w3.org/2001/XInclude">
<div xmlns="http://www.w3.org/1999/xhtml" id="universal_header" xml:base="http://127.0.0.1/sites/static/header_footer">
<section class="usa-banner">
<div class="usa-accordion">
<header class="usa-banner-header">
<div class="usa-grid usa-banner-inner">
<img src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/favicons/favicon-57.png" alt="U.S. flag" />
<p>An official website of the United States government</p>
<button class="non-usa-accordion-button usa-banner-button" aria-expanded="false" aria-controls="gov-banner-top" type="button">
<span class="usa-banner-button-text">Here's how you know</span>
</button>
</div>
</header>
<div class="usa-banner-content usa-grid usa-accordion-content" id="gov-banner-top" aria-hidden="true">
<div class="usa-banner-guidance-gov usa-width-one-half">
<img class="usa-banner-icon usa-media_block-img" src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/icon-dot-gov.svg" alt="Dot gov" />
<div class="usa-media_block-body">
<p>
<strong>The .gov means it's official.</strong>
<br />
Federal government websites often end in .gov or .mil. Before
sharing sensitive information, make sure you're on a federal
government site.
</p>
</div>
</div>
<div class="usa-banner-guidance-ssl usa-width-one-half">
<img class="usa-banner-icon usa-media_block-img" src="https://www.ncbi.nlm.nih.gov/coreutils/uswds/img/icon-https.svg" alt="Https" />
<div class="usa-media_block-body">
<p>
<strong>The site is secure.</strong>
<br />
The <strong>https://</strong> ensures that you are connecting to the
official website and that any information you provide is encrypted
and transmitted securely.
</p>
</div>
</div>
</div>
</div>
</section>
<div class="usa-overlay"></div>
<header class="ncbi-header" role="banner" data-section="Header">
<div class="usa-grid">
<div class="usa-width-one-whole">
<div class="ncbi-header__logo">
<a href="/" class="logo" aria-label="NCBI Logo" data-ga-action="click_image" data-ga-label="NIH NLM Logo">
<img src="https://www.ncbi.nlm.nih.gov/coreutils/nwds/img/logos/AgencyLogo.svg" alt="NIH NLM Logo" />
</a>
</div>
<div class="ncbi-header__account">
<a id="account_login" href="https://account.ncbi.nlm.nih.gov" class="usa-button header-button" style="display:none" data-ga-action="open_menu" data-ga-label="account_menu">Log in</a>
<button id="account_info" class="header-button" style="display:none" aria-controls="account_popup" type="button">
<span class="fa fa-user" aria-hidden="true">
<svg xmlns="http://www.w3.org/2000/svg" viewBox="0 0 24 24" width="20px" height="20px">
<g style="fill: #fff">
<ellipse cx="12" cy="8" rx="5" ry="6"></ellipse>
<path d="M21.8,19.1c-0.9-1.8-2.6-3.3-4.8-4.2c-0.6-0.2-1.3-0.2-1.8,0.1c-1,0.6-2,0.9-3.2,0.9s-2.2-0.3-3.2-0.9 C8.3,14.8,7.6,14.7,7,15c-2.2,0.9-3.9,2.4-4.8,4.2C1.5,20.5,2.6,22,4.1,22h15.8C21.4,22,22.5,20.5,21.8,19.1z"></path>
</g>
</svg>
</span>
<span class="username desktop-only" aria-hidden="true" id="uname_short"></span>
<span class="sr-only">Show account info</span>
</button>
</div>
<div class="ncbi-popup-anchor">
<div class="ncbi-popup account-popup" id="account_popup" aria-hidden="true">
<div class="ncbi-popup-head">
<button class="ncbi-close-button" data-ga-action="close_menu" data-ga-label="account_menu" type="button">
<span class="fa fa-times">
<svg xmlns="http://www.w3.org/2000/svg" viewBox="0 0 48 48" width="24px" height="24px">
<path d="M38 12.83l-2.83-2.83-11.17 11.17-11.17-11.17-2.83 2.83 11.17 11.17-11.17 11.17 2.83 2.83 11.17-11.17 11.17 11.17 2.83-2.83-11.17-11.17z"></path>
</svg>
</span>
<span class="usa-sr-only">Close</span></button>
<h4>Account</h4>
</div>
<div class="account-user-info">
Logged in as:<br />
<b><span class="username" id="uname_long">username</span></b>
</div>
<div class="account-links">
<ul class="usa-unstyled-list">
<li><a id="account_myncbi" href="/myncbi/" class="set-base-url" data-ga-action="click_menu_item" data-ga-label="account_myncbi">Dashboard</a></li>
<li><a id="account_pubs" href="/myncbi/collections/bibliography/" class="set-base-url" data-ga-action="click_menu_item" data-ga-label="account_pubs">Publications</a></li>
<li><a id="account_settings" href="/account/settings/" class="set-base-url" data-ga-action="click_menu_item" data-ga-label="account_settings">Account settings</a></li>
<li><a id="account_logout" href="/account/signout/" class="set-base-url" data-ga-action="click_menu_item" data-ga-label="account_logout">Log out</a></li>
</ul>
</div>
</div>
</div>
</div>
</div>
</header>
<div role="navigation" aria-label="access keys">
<a id="nws_header_accesskey_0" href="https://www.ncbi.nlm.nih.gov/guide/browsers/#ncbi_accesskeys" class="usa-sr-only" accesskey="0" tabindex="-1">Access keys</a>
<a id="nws_header_accesskey_1" href="https://www.ncbi.nlm.nih.gov" class="usa-sr-only" accesskey="1" tabindex="-1">NCBI Homepage</a>
<a id="nws_header_accesskey_2" href="/myncbi/" class="set-base-url usa-sr-only" accesskey="2" tabindex="-1">MyNCBI Homepage</a>
<a id="nws_header_accesskey_3" href="#maincontent" class="usa-sr-only" accesskey="3" tabindex="-1">Main Content</a>
<a id="nws_header_accesskey_4" href="#" class="usa-sr-only" accesskey="4" tabindex="-1">Main Navigation</a>
</div>
<section data-section="Alerts">
<div class="ncbi-alerts-placeholder"></div>
</section>
</div>
</div>
<!--/.header-->
<div class="header">
<div class="res_logo"><h1 class="res_name"><a href="/genbank/" title="GenBank home">GenBank</a></h1><h2 class="res_tagline">Public nucleic acid sequence repository</h2></div>
<div class="search"><form method="get" action="/nuccore/"><div class="search_form"><label for="database" class="offscreen_noflow">Search database</label><select id="database"><optgroup label="Recent"><option value="nuccore" selected="selected">Nucleotide</option><option value="books">Books</option><option value="refseq">RefSeq</option><option value="clinvar" class="last">ClinVar</option></optgroup><optgroup label="All"><option value="gquery">All Databases</option><option value="assembly">Assembly</option><option value="biocollections">Biocollections</option><option value="bioproject">BioProject</option><option value="biosample">BioSample</option><option value="books">Books</option><option value="clinvar">ClinVar</option><option value="cdd">Conserved Domains</option><option value="gap">dbGaP</option><option value="dbvar">dbVar</option><option value="gene">Gene</option><option value="genome">Genome</option><option value="gds">GEO DataSets</option><option value="geoprofiles">GEO Profiles</option><option value="gtr">GTR</option><option value="ipg">Identical Protein Groups</option><option value="medgen">MedGen</option><option value="mesh">MeSH</option><option value="nlmcatalog">NLM Catalog</option><option value="nuccore">Nucleotide</option><option value="omim">OMIM</option><option value="pmc">PMC</option><option value="protein">Protein</option><option value="proteinclusters">Protein Clusters</option><option value="protfam">Protein Family Models</option><option value="pcassay">PubChem BioAssay</option><option value="pccompound">PubChem Compound</option><option value="pcsubstance">PubChem Substance</option><option value="pubmed">PubMed</option><option value="snp">SNP</option><option value="sra">SRA</option><option value="structure">Structure</option><option value="taxonomy">Taxonomy</option><option value="toolkit">ToolKit</option><option value="toolkitall">ToolKitAll</option><option value="toolkitbookgh">ToolKitBookgh</option></optgroup></select><div class="nowrap"><label for="term" class="offscreen_noflow" accesskey="/">Search term</label><div class="nowrap"><input type="text" name="term" id="term" title="Search Nucleotide" value="" class="jig-ncbiclearbutton jig-ncbiautocomplete" data-jigconfig="isEnabled:false,disableUrl:'NcbiSearchBarAutoComplCtrl'" autocomplete="off" data-sbconfig="ds:'no',pjs:'no',afs:'yes'" /></div><button id="search" type="submit" class="button_search nowrap" cmd="go">Search</button></div></div></form></div>
</div>
<div class="nav_and_browser">
<div class="localnav"><ul class="jig-ncbilocalnav">
<li><a href="#">GenBank</a><ul>
<li><a href="/genbank/">About GenBank</a></li>
<li><a href="/genbank/submit_types">Submission Types</a></li>
<li><a href="/genbank/submit">Submission Tools</a></li>
<li><a href="/genbank/update">Update GenBank Records</a></li>
<li><a href="/nuccore/">Search</a></li>
<li><a href="/BLAST/Blast.cgi?CMD=Web&amp;PAGETYPE=BLASTHome">BLAST</a></li>
<li><a href="/genbank/statistics">Statistics</a></li>
<li><a href="/genbank/samplerecord/">Sample Record</a></li>
<li><a href="/genbank/sequencerevisionhistory/">Revision History</a></li>
<li><a href="/genbank/sequenceids/">Sequence IDs</a></li>
</ul>
</li>
<li><a href="#">Submit</a><ul>
<li><a href="/genbank/submit">Submission Tools</a></li>
<li><a href="/genbank/submit_types">Submission Types</a></li>
<li><a href="/WebSub/?tool=genbank">BankIt</a></li>
<li><a href="/genbank/table2asn">table2asn</a></li>
<li><a href="https://www.ncbi.nlm.nih.gov/sra/docs/sequence-data-processing">Sequence Data Processing</a></li>
</ul>
</li>
<li><a href="#">Genomes</a><ul>
<li><a href="/genbank/genomesubmit">Complete Genome Submission Guide</a></li>
<li><a href="/genbank/genomesubmit_annotation">Prokaryotic Genome Annotation Guide</a></li>
<li><a href="/genbank/eukaryotic_genome_submission_annotation">Eukaryotic Genome Annotation Guide</a></li>
<li><a href="/genbank/examples.wgs">Annotation Examples</a></li>
<li><a href="https://submit.ncbi.nlm.nih.gov/subs/wgs/">Genome Submission Portal</a></li>
</ul>
</li>
<li><a title="Whole Genome Shotgun sequences and submissions" href="#">WGS</a><ul>
<li><a href="/genbank/wgs">About WGS</a></li>
<li><a href="/Traces/wgs">WGS Project List</a></li>
<li><a href="/genbank/wgs.submit">WGS Submission Guide</a></li>
<li><a href="/genbank/wgsfaq/">FAQ</a></li>
<li><a href="https://submit.ncbi.nlm.nih.gov/subs/wgs/">Genome Submission Portal</a></li>
<li><a href="/genbank/eukaryotic_genome_submission_annotation">Eukaryotic Annotation Guide</a></li>
<li><a href="/genbank/genomesubmit_annotation">Prokaryotic Annotation Guide</a></li>
<li><a href="/genbank/asndisc">Discrepancy Report</a></li>
<li><a href="/assembly/agp/AGP_Specification/">AGP format</a></li>
</ul>
</li>
<li><a href="#">Metagenomes</a><ul>
<li><a href="/genbank/metagenome">About Metagenomes</a></li>
<li><a href="/genbank/structuredcomment">Structured Comment</a></li>
</ul>
</li>
<li><a href="#">TPA</a><ul>
<li><a href="/genbank/TPA">About TPA</a></li>
<li><a href="/genbank/tpafaq">FAQ</a></li>
<li><a href="/genbank/TPA-Exp">TPA-Exp</a></li>
<li><a href="/genbank/TPA-Inf">TPA-Inf</a></li>
</ul>
</li>
<li><a href="#">TSA</a><ul>
<li><a href="/genbank/TSA">About TSA</a></li>
<li><a href="/genbank/TSAguide">TSA Submission Guide</a></li>
<li><a href="/genbank/TSAfaq">FAQ</a></li>
</ul>
</li>
<li><a href="#">INSDC</a><ul>
<li><a href="/genbank/collab">About INSDC</a></li>
<li><a href="/genbank/collab/country">Geographic Location Name List</a></li>
<li><a href="/genbank/collab/db_xref">db_xref List</a></li>
<li><a href="http://www.insdc.org/documents/feature_table.html">Feature Table</a></li>
</ul>
</li>
<li><a href="#">Documentation</a><ul>
<li><a href="https://www.ncbi.nlm.nih.gov/sra/docs/sequence-data-processing/">Sequence Data Processing</a></li>
<li><a href="/genbank/submission_brokers">Submission Brokers</a></li>
<li><a href="/genbank/acc_prefix">Accession Number Prefixes</a></li>
<li><a href="/genbank/organelle_submit/">Organelle Submission Guide</a></li>
<li><a href="/genbank/monkeypox_submission/">Monkeypox Submission Guide</a></li>
<li><a href="/genbank/validation/">Common Submission Errors</a> </li>
<li><a href="/genbank/sequencecheck/">Ribosomal Submission Errors</a></li>
<li><a href="/genbank/sequencecheck/virus">Common Sequence Errors</a></li>
<li><a href="https://support.nlm.nih.gov/knowledgebase/category/?id=CAT-01240">Submission FAQs</a></li>
</ul>
</li>
<li><a href="#">Other</a><ul>
<li><a href="/genbank/htgs">About HTGs</a></li>
<li><a href="/genbank/dbest">About EST</a></li>
<li><a href="/genbank/dbgss">About GSS</a></li>
<li><a href="/genbank/tls">About TLS</a></li>
<li><a href="/genbank/tlsguide">Submit TLS</a></li>
</ul>
</li>
</ul></div>
</div>
<!-- was itemctrl -->
<div class="container">
<div id="maincontent" class="content col twelve_col last">
<div class="col1">
<h1>Current GenBank Release Notes</h1>
<pre>GBREL.TXT Genetic Sequence Data Bank
February 15 2025
NCBI-GenBank Flat File Release 265.0
Distribution Release Notes
255669865 sequences, 5415448651743 bases, for traditional GenBank records
5303887188 sequences, 36546479885769 bases, for set-based (WGS/TSA/TLS) records
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 265.0
1.2 Cutoff Date
1.3 Important Changes in Release 265.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 265.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use Submission Portal or BankIt for
sending sequence data.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
Email: gb-sub@ncbi.nlm.nih.gov
Updates and changes to existing GenBank records:
https://www.ncbi.nlm.nih.gov/genbank/update/
Email: update@ncbi.nlm.nih.gov
URLs for GenBank's web-based submission tools:
Submission Portal https://submit.ncbi.nlm.nih.gov/
BankIt https://www.ncbi.nlm.nih.gov/WebSub/
See Section 1.5 for additional details about submitting data to GenBank.
*****************************************************************************
GenBank Release 265.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:
ftp://ftp.ncbi.nih.gov/genbank/wgs
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/tsa
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tls
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
See the README files in those areas for more information.
1.2 Cutoff Date
This full release, 265.0, incorporates data processed by the INSDC databases
as of Thursday February 27 2025, 9:02PM EST. For more recent data, users are
advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotide' database (see Section 6.4 of this document).
1.3 Important Changes in Release 265.0
1.3.1 Organizational changes
The total number of sequence data files for traditional GenBank records
(non-WGS/TSA/TLS) increased by 317 with this release:
- the BCT division is now composed of 428 files (+16)
- the ENV division is now composed of 30 files (+3)
- the INV division is now composed of 1212 files (+130)
- the MAM division is now composed of 173 files (+8)
- the PAT division is now composed of 81 files (+1)
- the PLN division is now composed of 1977 files (+102)
- the SYN division is now composed of 10 files (+1)
- the VRL division is now composed of 337 files (+4)
- the VRT division is now composed of 369 files (+52)
1.4 Upcoming Changes
1.4.1 There are currently no planned changes for GenBank Flatfile FTP products.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank utilizing the tools summarized below.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. General
information for submitting to Genbank is available online:
https://www.ncbi.nlm.nih.gov/genbank/submit/
To assist researchers in entering their own sequence data, GenBank
provides Web-based submission tools: Submission Portal and Bankit.
Submission Portal https://submit.ncbi.nlm.nih.gov/
BankIt https://www.ncbi.nlm.nih.gov/WebSub/
Submission Portal provides an efficient submission pathway for high
frequency submission types (e.g., 16S rRNA, rRNA-ITS, metazoan COX1,
SARS-CoV-2, etc.).
BankIt is an easy-to-use program that enables authors to enter one
or more sequences, annotate, and submit to GenBank. BankIt provides
a simple forms-based approach for submitting your sequence and the
relevant associated metadata to GenBank.
Genbank also provides submission preparation tools which require uploading
via the Submission Portal or email to gb-sub@ncbi.nlm.nih.gov when relevant:
table2asn: https://www.ncbi.nlm.nih.gov/genbank/table2asn/
table2asn is a command-line program that automates the creation of sequence
records for submission to GenBank. It is used primarily for submission of
complete genomes and large batches of sequences and is available by FTP
for use on MAC, PC and Unix platforms:
https://ftp.ncbi.nlm.nih.gov/asn1-converters/by_program/table2asn/
Genome Workbench offers a rich set of integrated tools for studying
and analyzing genetic data. The Submission Wizard allows you to prepare
submissions of single eukaryotic and prokaryotic genomes. You can also
use Genome Workbench to edit and visualize an ASN.1 file created by table2asn.
Genome Workbench: https://www.ncbi.nlm.nih.gov/tools/gbench/
Through the international collaboration of DNA sequence databases,
GenBank submissions are forwarded daily for inclusion in the European
Nucleotide Archive (ENA) and the DNA Databank of Japan (DDBJ).
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
SEQUIN. As of January 2021, Sequin sequence submissions are no longer
accepted by GenBank, and the Sequin application is no longer distributed
by NCBI. See: https://ncbiinsights.ncbi.nlm.nih.gov/tag/sequin/
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov .
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.
2.2 Files
This GenBank flat file release consists of 5797 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct419.seq - Bacterial sequence entries, part 419.
357. gbbct42.seq - Bacterial sequence entries, part 42.
358. gbbct420.seq - Bacterial sequence entries, part 420.
359. gbbct421.seq - Bacterial sequence entries, part 421.
360. gbbct422.seq - Bacterial sequence entries, part 422.
361. gbbct423.seq - Bacterial sequence entries, part 423.
362. gbbct424.seq - Bacterial sequence entries, part 424.
363. gbbct425.seq - Bacterial sequence entries, part 425.
364. gbbct426.seq - Bacterial sequence entries, part 426.
365. gbbct427.seq - Bacterial sequence entries, part 427.
366. gbbct428.seq - Bacterial sequence entries, part 428.
367. gbbct43.seq - Bacterial sequence entries, part 43.
368. gbbct44.seq - Bacterial sequence entries, part 44.
369. gbbct45.seq - Bacterial sequence entries, part 45.
370. gbbct46.seq - Bacterial sequence entries, part 46.
371. gbbct47.seq - Bacterial sequence entries, part 47.
372. gbbct48.seq - Bacterial sequence entries, part 48.
373. gbbct49.seq - Bacterial sequence entries, part 49.
374. gbbct5.seq - Bacterial sequence entries, part 5.
375. gbbct50.seq - Bacterial sequence entries, part 50.
376. gbbct51.seq - Bacterial sequence entries, part 51.
377. gbbct52.seq - Bacterial sequence entries, part 52.
378. gbbct53.seq - Bacterial sequence entries, part 53.
379. gbbct54.seq - Bacterial sequence entries, part 54.
380. gbbct55.seq - Bacterial sequence entries, part 55.
381. gbbct56.seq - Bacterial sequence entries, part 56.
382. gbbct57.seq - Bacterial sequence entries, part 57.
383. gbbct58.seq - Bacterial sequence entries, part 58.
384. gbbct59.seq - Bacterial sequence entries, part 59.
385. gbbct6.seq - Bacterial sequence entries, part 6.
386. gbbct60.seq - Bacterial sequence entries, part 60.
387. gbbct61.seq - Bacterial sequence entries, part 61.
388. gbbct62.seq - Bacterial sequence entries, part 62.
389. gbbct63.seq - Bacterial sequence entries, part 63.
390. gbbct64.seq - Bacterial sequence entries, part 64.
391. gbbct65.seq - Bacterial sequence entries, part 65.
392. gbbct66.seq - Bacterial sequence entries, part 66.
393. gbbct67.seq - Bacterial sequence entries, part 67.
394. gbbct68.seq - Bacterial sequence entries, part 68.
395. gbbct69.seq - Bacterial sequence entries, part 69.
396. gbbct7.seq - Bacterial sequence entries, part 7.
397. gbbct70.seq - Bacterial sequence entries, part 70.
398. gbbct71.seq - Bacterial sequence entries, part 71.
399. gbbct72.seq - Bacterial sequence entries, part 72.
400. gbbct73.seq - Bacterial sequence entries, part 73.
401. gbbct74.seq - Bacterial sequence entries, part 74.
402. gbbct75.seq - Bacterial sequence entries, part 75.
403. gbbct76.seq - Bacterial sequence entries, part 76.
404. gbbct77.seq - Bacterial sequence entries, part 77.
405. gbbct78.seq - Bacterial sequence entries, part 78.
406. gbbct79.seq - Bacterial sequence entries, part 79.
407. gbbct8.seq - Bacterial sequence entries, part 8.
408. gbbct80.seq - Bacterial sequence entries, part 80.
409. gbbct81.seq - Bacterial sequence entries, part 81.
410. gbbct82.seq - Bacterial sequence entries, part 82.
411. gbbct83.seq - Bacterial sequence entries, part 83.
412. gbbct84.seq - Bacterial sequence entries, part 84.
413. gbbct85.seq - Bacterial sequence entries, part 85.
414. gbbct86.seq - Bacterial sequence entries, part 86.
415. gbbct87.seq - Bacterial sequence entries, part 87.
416. gbbct88.seq - Bacterial sequence entries, part 88.
417. gbbct89.seq - Bacterial sequence entries, part 89.
418. gbbct9.seq - Bacterial sequence entries, part 9.
419. gbbct90.seq - Bacterial sequence entries, part 90.
420. gbbct91.seq - Bacterial sequence entries, part 91.
421. gbbct92.seq - Bacterial sequence entries, part 92.
422. gbbct93.seq - Bacterial sequence entries, part 93.
423. gbbct94.seq - Bacterial sequence entries, part 94.
424. gbbct95.seq - Bacterial sequence entries, part 95.
425. gbbct96.seq - Bacterial sequence entries, part 96.
426. gbbct97.seq - Bacterial sequence entries, part 97.
427. gbbct98.seq - Bacterial sequence entries, part 98.
428. gbbct99.seq - Bacterial sequence entries, part 99.
429. gbchg.txt - Accession numbers of entries updated since the previous release.
430. gbcon1.seq - Constructed sequence entries, part 1.
431. gbcon10.seq - Constructed sequence entries, part 10.
432. gbcon11.seq - Constructed sequence entries, part 11.
433. gbcon12.seq - Constructed sequence entries, part 12.
434. gbcon13.seq - Constructed sequence entries, part 13.
435. gbcon14.seq - Constructed sequence entries, part 14.
436. gbcon15.seq - Constructed sequence entries, part 15.
437. gbcon16.seq - Constructed sequence entries, part 16.
438. gbcon17.seq - Constructed sequence entries, part 17.
439. gbcon18.seq - Constructed sequence entries, part 18.
440. gbcon19.seq - Constructed sequence entries, part 19.
441. gbcon2.seq - Constructed sequence entries, part 2.
442. gbcon20.seq - Constructed sequence entries, part 20.
443. gbcon21.seq - Constructed sequence entries, part 21.
444. gbcon22.seq - Constructed sequence entries, part 22.
445. gbcon23.seq - Constructed sequence entries, part 23.
446. gbcon24.seq - Constructed sequence entries, part 24.
447. gbcon25.seq - Constructed sequence entries, part 25.
448. gbcon26.seq - Constructed sequence entries, part 26.
449. gbcon27.seq - Constructed sequence entries, part 27.
450. gbcon28.seq - Constructed sequence entries, part 28.
451. gbcon29.seq - Constructed sequence entries, part 29.
452. gbcon3.seq - Constructed sequence entries, part 3.
453. gbcon30.seq - Constructed sequence entries, part 30.
454. gbcon31.seq - Constructed sequence entries, part 31.
455. gbcon32.seq - Constructed sequence entries, part 32.
456. gbcon33.seq - Constructed sequence entries, part 33.
457. gbcon34.seq - Constructed sequence entries, part 34.
458. gbcon35.seq - Constructed sequence entries, part 35.
459. gbcon36.seq - Constructed sequence entries, part 36.
460. gbcon37.seq - Constructed sequence entries, part 37.
461. gbcon38.seq - Constructed sequence entries, part 38.
462. gbcon39.seq - Constructed sequence entries, part 39.
463. gbcon4.seq - Constructed sequence entries, part 4.
464. gbcon40.seq - Constructed sequence entries, part 40.
465. gbcon41.seq - Constructed sequence entries, part 41.
466. gbcon42.seq - Constructed sequence entries, part 42.
467. gbcon43.seq - Constructed sequence entries, part 43.
468. gbcon44.seq - Constructed sequence entries, part 44.
469. gbcon45.seq - Constructed sequence entries, part 45.
470. gbcon46.seq - Constructed sequence entries, part 46.
471. gbcon47.seq - Constructed sequence entries, part 47.
472. gbcon48.seq - Constructed sequence entries, part 48.
473. gbcon49.seq - Constructed sequence entries, part 49.
474. gbcon5.seq - Constructed sequence entries, part 5.
475. gbcon50.seq - Constructed sequence entries, part 50.
476. gbcon51.seq - Constructed sequence entries, part 51.
477. gbcon52.seq - Constructed sequence entries, part 52.
478. gbcon53.seq - Constructed sequence entries, part 53.
479. gbcon54.seq - Constructed sequence entries, part 54.
480. gbcon55.seq - Constructed sequence entries, part 55.
481. gbcon56.seq - Constructed sequence entries, part 56.
482. gbcon57.seq - Constructed sequence entries, part 57.
483. gbcon58.seq - Constructed sequence entries, part 58.
484. gbcon59.seq - Constructed sequence entries, part 59.
485. gbcon6.seq - Constructed sequence entries, part 6.
486. gbcon60.seq - Constructed sequence entries, part 60.
487. gbcon61.seq - Constructed sequence entries, part 61.
488. gbcon62.seq - Constructed sequence entries, part 62.
489. gbcon63.seq - Constructed sequence entries, part 63.
490. gbcon64.seq - Constructed sequence entries, part 64.
491. gbcon65.seq - Constructed sequence entries, part 65.
492. gbcon66.seq - Constructed sequence entries, part 66.
493. gbcon67.seq - Constructed sequence entries, part 67.
494. gbcon68.seq - Constructed sequence entries, part 68.
495. gbcon7.seq - Constructed sequence entries, part 7.
496. gbcon8.seq - Constructed sequence entries, part 8.
497. gbcon9.seq - Constructed sequence entries, part 9.
498. gbdel.txt - Accession numbers of entries deleted since the previous release.
499. gbenv1.seq - Environmental sampling sequence entries, part 1.
500. gbenv10.seq - Environmental sampling sequence entries, part 10.
501. gbenv11.seq - Environmental sampling sequence entries, part 11.
502. gbenv12.seq - Environmental sampling sequence entries, part 12.
503. gbenv13.seq - Environmental sampling sequence entries, part 13.
504. gbenv14.seq - Environmental sampling sequence entries, part 14.
505. gbenv15.seq - Environmental sampling sequence entries, part 15.
506. gbenv16.seq - Environmental sampling sequence entries, part 16.
507. gbenv17.seq - Environmental sampling sequence entries, part 17.
508. gbenv18.seq - Environmental sampling sequence entries, part 18.
509. gbenv19.seq - Environmental sampling sequence entries, part 19.
510. gbenv2.seq - Environmental sampling sequence entries, part 2.
511. gbenv20.seq - Environmental sampling sequence entries, part 20.
512. gbenv21.seq - Environmental sampling sequence entries, part 21.
513. gbenv22.seq - Environmental sampling sequence entries, part 22.
514. gbenv23.seq - Environmental sampling sequence entries, part 23.
515. gbenv24.seq - Environmental sampling sequence entries, part 24.
516. gbenv25.seq - Environmental sampling sequence entries, part 25.
517. gbenv26.seq - Environmental sampling sequence entries, part 26.
518. gbenv27.seq - Environmental sampling sequence entries, part 27.
519. gbenv28.seq - Environmental sampling sequence entries, part 28.
520. gbenv29.seq - Environmental sampling sequence entries, part 29.
521. gbenv3.seq - Environmental sampling sequence entries, part 3.
522. gbenv30.seq - Environmental sampling sequence entries, part 30.
523. gbenv4.seq - Environmental sampling sequence entries, part 4.
524. gbenv5.seq - Environmental sampling sequence entries, part 5.
525. gbenv6.seq - Environmental sampling sequence entries, part 6.
526. gbenv7.seq - Environmental sampling sequence entries, part 7.
527. gbenv8.seq - Environmental sampling sequence entries, part 8.
528. gbenv9.seq - Environmental sampling sequence entries, part 9.
529. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
530. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
531. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
532. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
533. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
534. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
535. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
536. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
537. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
538. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
539. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
540. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
541. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
542. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
543. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
544. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
545. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
546. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
547. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
548. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
549. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
550. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
551. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
552. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
553. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
554. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
555. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
556. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
557. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
558. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
559. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
560. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
561. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
562. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
563. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
564. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
565. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
566. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
567. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
568. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
569. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
570. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
571. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
572. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
573. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
574. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
575. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
576. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
577. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
578. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
579. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
580. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
581. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
582. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
583. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
584. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
585. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
586. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
587. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
588. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
589. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
590. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
591. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
592. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
593. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
594. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
595. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
596. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
597. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
598. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
599. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
600. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
601. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
602. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
603. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
604. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
605. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
606. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
607. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
608. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
609. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
610. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
611. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
612. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
613. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
614. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
615. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
616. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
617. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
618. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
619. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
620. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
621. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
622. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
623. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
624. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
625. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
626. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
627. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
628. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
629. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
630. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
631. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
632. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
633. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
634. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
635. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
636. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
637. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
638. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
639. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
640. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
641. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
642. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
643. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
644. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
645. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
646. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
647. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
648. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
649. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
650. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
651. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
652. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
653. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
654. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
655. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
656. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
657. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
658. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
659. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
660. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
661. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
662. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
663. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
664. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
665. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
666. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
667. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
668. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
669. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
670. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
671. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
672. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
673. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
674. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
675. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
676. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
677. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
678. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
679. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
680. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
681. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
682. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
683. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
684. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
685. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
686. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
687. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
688. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
689. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
690. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
691. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
692. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
693. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
694. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
695. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
696. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
697. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
698. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
699. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
700. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
701. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
702. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
703. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
704. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
705. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
706. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
707. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
708. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
709. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
710. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
711. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
712. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
713. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
714. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
715. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
716. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
717. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
718. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
719. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
720. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
721. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
722. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
723. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
724. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
725. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
726. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
727. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
728. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
729. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
730. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
731. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
732. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
733. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
734. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
735. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
736. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
737. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
738. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
739. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
740. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
741. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
742. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
743. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
744. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
745. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
746. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
747. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
748. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
749. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
750. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
751. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
752. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
753. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
754. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
755. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
756. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
757. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
758. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
759. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
760. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
761. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
762. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
763. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
764. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
765. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
766. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
767. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
768. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
769. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
770. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
771. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
772. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
773. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
774. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
775. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
776. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
777. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
778. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
779. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
780. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
781. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
782. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
783. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
784. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
785. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
786. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
787. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
788. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
789. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
790. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
791. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
792. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
793. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
794. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
795. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
796. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
797. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
798. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
799. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
800. gbinv1.seq - Invertebrate sequence entries, part 1.
801. gbinv10.seq - Invertebrate sequence entries, part 10.
802. gbinv100.seq - Invertebrate sequence entries, part 100.
803. gbinv1000.seq - Invertebrate sequence entries, part 1000.
804. gbinv1001.seq - Invertebrate sequence entries, part 1001.
805. gbinv1002.seq - Invertebrate sequence entries, part 1002.
806. gbinv1003.seq - Invertebrate sequence entries, part 1003.
807. gbinv1004.seq - Invertebrate sequence entries, part 1004.
808. gbinv1005.seq - Invertebrate sequence entries, part 1005.
809. gbinv1006.seq - Invertebrate sequence entries, part 1006.
810. gbinv1007.seq - Invertebrate sequence entries, part 1007.
811. gbinv1008.seq - Invertebrate sequence entries, part 1008.
812. gbinv1009.seq - Invertebrate sequence entries, part 1009.
813. gbinv101.seq - Invertebrate sequence entries, part 101.
814. gbinv1010.seq - Invertebrate sequence entries, part 1010.
815. gbinv1011.seq - Invertebrate sequence entries, part 1011.
816. gbinv1012.seq - Invertebrate sequence entries, part 1012.
817. gbinv1013.seq - Invertebrate sequence entries, part 1013.
818. gbinv1014.seq - Invertebrate sequence entries, part 1014.
819. gbinv1015.seq - Invertebrate sequence entries, part 1015.
820. gbinv1016.seq - Invertebrate sequence entries, part 1016.
821. gbinv1017.seq - Invertebrate sequence entries, part 1017.
822. gbinv1018.seq - Invertebrate sequence entries, part 1018.
823. gbinv1019.seq - Invertebrate sequence entries, part 1019.
824. gbinv102.seq - Invertebrate sequence entries, part 102.
825. gbinv1020.seq - Invertebrate sequence entries, part 1020.
826. gbinv1021.seq - Invertebrate sequence entries, part 1021.
827. gbinv1022.seq - Invertebrate sequence entries, part 1022.
828. gbinv1023.seq - Invertebrate sequence entries, part 1023.
829. gbinv1024.seq - Invertebrate sequence entries, part 1024.
830. gbinv1025.seq - Invertebrate sequence entries, part 1025.
831. gbinv1026.seq - Invertebrate sequence entries, part 1026.
832. gbinv1027.seq - Invertebrate sequence entries, part 1027.
833. gbinv1028.seq - Invertebrate sequence entries, part 1028.
834. gbinv1029.seq - Invertebrate sequence entries, part 1029.
835. gbinv103.seq - Invertebrate sequence entries, part 103.
836. gbinv1030.seq - Invertebrate sequence entries, part 1030.
837. gbinv1031.seq - Invertebrate sequence entries, part 1031.
838. gbinv1032.seq - Invertebrate sequence entries, part 1032.
839. gbinv1033.seq - Invertebrate sequence entries, part 1033.
840. gbinv1034.seq - Invertebrate sequence entries, part 1034.
841. gbinv1035.seq - Invertebrate sequence entries, part 1035.
842. gbinv1036.seq - Invertebrate sequence entries, part 1036.
843. gbinv1037.seq - Invertebrate sequence entries, part 1037.
844. gbinv1038.seq - Invertebrate sequence entries, part 1038.
845. gbinv1039.seq - Invertebrate sequence entries, part 1039.
846. gbinv104.seq - Invertebrate sequence entries, part 104.
847. gbinv1040.seq - Invertebrate sequence entries, part 1040.
848. gbinv1041.seq - Invertebrate sequence entries, part 1041.
849. gbinv1042.seq - Invertebrate sequence entries, part 1042.
850. gbinv1043.seq - Invertebrate sequence entries, part 1043.
851. gbinv1044.seq - Invertebrate sequence entries, part 1044.
852. gbinv1045.seq - Invertebrate sequence entries, part 1045.
853. gbinv1046.seq - Invertebrate sequence entries, part 1046.
854. gbinv1047.seq - Invertebrate sequence entries, part 1047.
855. gbinv1048.seq - Invertebrate sequence entries, part 1048.
856. gbinv1049.seq - Invertebrate sequence entries, part 1049.
857. gbinv105.seq - Invertebrate sequence entries, part 105.
858. gbinv1050.seq - Invertebrate sequence entries, part 1050.
859. gbinv1051.seq - Invertebrate sequence entries, part 1051.
860. gbinv1052.seq - Invertebrate sequence entries, part 1052.
861. gbinv1053.seq - Invertebrate sequence entries, part 1053.
862. gbinv1054.seq - Invertebrate sequence entries, part 1054.
863. gbinv1055.seq - Invertebrate sequence entries, part 1055.
864. gbinv1056.seq - Invertebrate sequence entries, part 1056.
865. gbinv1057.seq - Invertebrate sequence entries, part 1057.
866. gbinv1058.seq - Invertebrate sequence entries, part 1058.
867. gbinv1059.seq - Invertebrate sequence entries, part 1059.
868. gbinv106.seq - Invertebrate sequence entries, part 106.
869. gbinv1060.seq - Invertebrate sequence entries, part 1060.
870. gbinv1061.seq - Invertebrate sequence entries, part 1061.
871. gbinv1062.seq - Invertebrate sequence entries, part 1062.
872. gbinv1063.seq - Invertebrate sequence entries, part 1063.
873. gbinv1064.seq - Invertebrate sequence entries, part 1064.
874. gbinv1065.seq - Invertebrate sequence entries, part 1065.
875. gbinv1066.seq - Invertebrate sequence entries, part 1066.
876. gbinv1067.seq - Invertebrate sequence entries, part 1067.
877. gbinv1068.seq - Invertebrate sequence entries, part 1068.
878. gbinv1069.seq - Invertebrate sequence entries, part 1069.
879. gbinv107.seq - Invertebrate sequence entries, part 107.
880. gbinv1070.seq - Invertebrate sequence entries, part 1070.
881. gbinv1071.seq - Invertebrate sequence entries, part 1071.
882. gbinv1072.seq - Invertebrate sequence entries, part 1072.
883. gbinv1073.seq - Invertebrate sequence entries, part 1073.
884. gbinv1074.seq - Invertebrate sequence entries, part 1074.
885. gbinv1075.seq - Invertebrate sequence entries, part 1075.
886. gbinv1076.seq - Invertebrate sequence entries, part 1076.
887. gbinv1077.seq - Invertebrate sequence entries, part 1077.
888. gbinv1078.seq - Invertebrate sequence entries, part 1078.
889. gbinv1079.seq - Invertebrate sequence entries, part 1079.
890. gbinv108.seq - Invertebrate sequence entries, part 108.
891. gbinv1080.seq - Invertebrate sequence entries, part 1080.
892. gbinv1081.seq - Invertebrate sequence entries, part 1081.
893. gbinv1082.seq - Invertebrate sequence entries, part 1082.
894. gbinv1083.seq - Invertebrate sequence entries, part 1083.
895. gbinv1084.seq - Invertebrate sequence entries, part 1084.
896. gbinv1085.seq - Invertebrate sequence entries, part 1085.
897. gbinv1086.seq - Invertebrate sequence entries, part 1086.
898. gbinv1087.seq - Invertebrate sequence entries, part 1087.
899. gbinv1088.seq - Invertebrate sequence entries, part 1088.
900. gbinv1089.seq - Invertebrate sequence entries, part 1089.
901. gbinv109.seq - Invertebrate sequence entries, part 109.
902. gbinv1090.seq - Invertebrate sequence entries, part 1090.
903. gbinv1091.seq - Invertebrate sequence entries, part 1091.
904. gbinv1092.seq - Invertebrate sequence entries, part 1092.
905. gbinv1093.seq - Invertebrate sequence entries, part 1093.
906. gbinv1094.seq - Invertebrate sequence entries, part 1094.
907. gbinv1095.seq - Invertebrate sequence entries, part 1095.
908. gbinv1096.seq - Invertebrate sequence entries, part 1096.
909. gbinv1097.seq - Invertebrate sequence entries, part 1097.
910. gbinv1098.seq - Invertebrate sequence entries, part 1098.
911. gbinv1099.seq - Invertebrate sequence entries, part 1099.
912. gbinv11.seq - Invertebrate sequence entries, part 11.
913. gbinv110.seq - Invertebrate sequence entries, part 110.
914. gbinv1100.seq - Invertebrate sequence entries, part 1100.
915. gbinv1101.seq - Invertebrate sequence entries, part 1101.
916. gbinv1102.seq - Invertebrate sequence entries, part 1102.
917. gbinv1103.seq - Invertebrate sequence entries, part 1103.
918. gbinv1104.seq - Invertebrate sequence entries, part 1104.
919. gbinv1105.seq - Invertebrate sequence entries, part 1105.
920. gbinv1106.seq - Invertebrate sequence entries, part 1106.
921. gbinv1107.seq - Invertebrate sequence entries, part 1107.
922. gbinv1108.seq - Invertebrate sequence entries, part 1108.
923. gbinv1109.seq - Invertebrate sequence entries, part 1109.
924. gbinv111.seq - Invertebrate sequence entries, part 111.
925. gbinv1110.seq - Invertebrate sequence entries, part 1110.
926. gbinv1111.seq - Invertebrate sequence entries, part 1111.
927. gbinv1112.seq - Invertebrate sequence entries, part 1112.
928. gbinv1113.seq - Invertebrate sequence entries, part 1113.
929. gbinv1114.seq - Invertebrate sequence entries, part 1114.
930. gbinv1115.seq - Invertebrate sequence entries, part 1115.
931. gbinv1116.seq - Invertebrate sequence entries, part 1116.
932. gbinv1117.seq - Invertebrate sequence entries, part 1117.
933. gbinv1118.seq - Invertebrate sequence entries, part 1118.
934. gbinv1119.seq - Invertebrate sequence entries, part 1119.
935. gbinv112.seq - Invertebrate sequence entries, part 112.
936. gbinv1120.seq - Invertebrate sequence entries, part 1120.
937. gbinv1121.seq - Invertebrate sequence entries, part 1121.
938. gbinv1122.seq - Invertebrate sequence entries, part 1122.
939. gbinv1123.seq - Invertebrate sequence entries, part 1123.
940. gbinv1124.seq - Invertebrate sequence entries, part 1124.
941. gbinv1125.seq - Invertebrate sequence entries, part 1125.
942. gbinv1126.seq - Invertebrate sequence entries, part 1126.
943. gbinv1127.seq - Invertebrate sequence entries, part 1127.
944. gbinv1128.seq - Invertebrate sequence entries, part 1128.
945. gbinv1129.seq - Invertebrate sequence entries, part 1129.
946. gbinv113.seq - Invertebrate sequence entries, part 113.
947. gbinv1130.seq - Invertebrate sequence entries, part 1130.
948. gbinv1131.seq - Invertebrate sequence entries, part 1131.
949. gbinv1132.seq - Invertebrate sequence entries, part 1132.
950. gbinv1133.seq - Invertebrate sequence entries, part 1133.
951. gbinv1134.seq - Invertebrate sequence entries, part 1134.
952. gbinv1135.seq - Invertebrate sequence entries, part 1135.
953. gbinv1136.seq - Invertebrate sequence entries, part 1136.
954. gbinv1137.seq - Invertebrate sequence entries, part 1137.
955. gbinv1138.seq - Invertebrate sequence entries, part 1138.
956. gbinv1139.seq - Invertebrate sequence entries, part 1139.
957. gbinv114.seq - Invertebrate sequence entries, part 114.
958. gbinv1140.seq - Invertebrate sequence entries, part 1140.
959. gbinv1141.seq - Invertebrate sequence entries, part 1141.
960. gbinv1142.seq - Invertebrate sequence entries, part 1142.
961. gbinv1143.seq - Invertebrate sequence entries, part 1143.
962. gbinv1144.seq - Invertebrate sequence entries, part 1144.
963. gbinv1145.seq - Invertebrate sequence entries, part 1145.
964. gbinv1146.seq - Invertebrate sequence entries, part 1146.
965. gbinv1147.seq - Invertebrate sequence entries, part 1147.
966. gbinv1148.seq - Invertebrate sequence entries, part 1148.
967. gbinv1149.seq - Invertebrate sequence entries, part 1149.
968. gbinv115.seq - Invertebrate sequence entries, part 115.
969. gbinv1150.seq - Invertebrate sequence entries, part 1150.
970. gbinv1151.seq - Invertebrate sequence entries, part 1151.
971. gbinv1152.seq - Invertebrate sequence entries, part 1152.
972. gbinv1153.seq - Invertebrate sequence entries, part 1153.
973. gbinv1154.seq - Invertebrate sequence entries, part 1154.
974. gbinv1155.seq - Invertebrate sequence entries, part 1155.
975. gbinv1156.seq - Invertebrate sequence entries, part 1156.
976. gbinv1157.seq - Invertebrate sequence entries, part 1157.
977. gbinv1158.seq - Invertebrate sequence entries, part 1158.
978. gbinv1159.seq - Invertebrate sequence entries, part 1159.
979. gbinv116.seq - Invertebrate sequence entries, part 116.
980. gbinv1160.seq - Invertebrate sequence entries, part 1160.
981. gbinv1161.seq - Invertebrate sequence entries, part 1161.
982. gbinv1162.seq - Invertebrate sequence entries, part 1162.
983. gbinv1163.seq - Invertebrate sequence entries, part 1163.
984. gbinv1164.seq - Invertebrate sequence entries, part 1164.
985. gbinv1165.seq - Invertebrate sequence entries, part 1165.
986. gbinv1166.seq - Invertebrate sequence entries, part 1166.
987. gbinv1167.seq - Invertebrate sequence entries, part 1167.
988. gbinv1168.seq - Invertebrate sequence entries, part 1168.
989. gbinv1169.seq - Invertebrate sequence entries, part 1169.
990. gbinv117.seq - Invertebrate sequence entries, part 117.
991. gbinv1170.seq - Invertebrate sequence entries, part 1170.
992. gbinv1171.seq - Invertebrate sequence entries, part 1171.
993. gbinv1172.seq - Invertebrate sequence entries, part 1172.
994. gbinv1173.seq - Invertebrate sequence entries, part 1173.
995. gbinv1174.seq - Invertebrate sequence entries, part 1174.
996. gbinv1175.seq - Invertebrate sequence entries, part 1175.
997. gbinv1176.seq - Invertebrate sequence entries, part 1176.
998. gbinv1177.seq - Invertebrate sequence entries, part 1177.
999. gbinv1178.seq - Invertebrate sequence entries, part 1178.
1000. gbinv1179.seq - Invertebrate sequence entries, part 1179.
1001. gbinv118.seq - Invertebrate sequence entries, part 118.
1002. gbinv1180.seq - Invertebrate sequence entries, part 1180.
1003. gbinv1181.seq - Invertebrate sequence entries, part 1181.
1004. gbinv1182.seq - Invertebrate sequence entries, part 1182.
1005. gbinv1183.seq - Invertebrate sequence entries, part 1183.
1006. gbinv1184.seq - Invertebrate sequence entries, part 1184.
1007. gbinv1185.seq - Invertebrate sequence entries, part 1185.
1008. gbinv1186.seq - Invertebrate sequence entries, part 1186.
1009. gbinv1187.seq - Invertebrate sequence entries, part 1187.
1010. gbinv1188.seq - Invertebrate sequence entries, part 1188.
1011. gbinv1189.seq - Invertebrate sequence entries, part 1189.
1012. gbinv119.seq - Invertebrate sequence entries, part 119.
1013. gbinv1190.seq - Invertebrate sequence entries, part 1190.
1014. gbinv1191.seq - Invertebrate sequence entries, part 1191.
1015. gbinv1192.seq - Invertebrate sequence entries, part 1192.
1016. gbinv1193.seq - Invertebrate sequence entries, part 1193.
1017. gbinv1194.seq - Invertebrate sequence entries, part 1194.
1018. gbinv1195.seq - Invertebrate sequence entries, part 1195.
1019. gbinv1196.seq - Invertebrate sequence entries, part 1196.
1020. gbinv1197.seq - Invertebrate sequence entries, part 1197.
1021. gbinv1198.seq - Invertebrate sequence entries, part 1198.
1022. gbinv1199.seq - Invertebrate sequence entries, part 1199.
1023. gbinv12.seq - Invertebrate sequence entries, part 12.
1024. gbinv120.seq - Invertebrate sequence entries, part 120.
1025. gbinv1200.seq - Invertebrate sequence entries, part 1200.
1026. gbinv1201.seq - Invertebrate sequence entries, part 1201.
1027. gbinv1202.seq - Invertebrate sequence entries, part 1202.
1028. gbinv1203.seq - Invertebrate sequence entries, part 1203.
1029. gbinv1204.seq - Invertebrate sequence entries, part 1204.
1030. gbinv1205.seq - Invertebrate sequence entries, part 1205.
1031. gbinv1206.seq - Invertebrate sequence entries, part 1206.
1032. gbinv1207.seq - Invertebrate sequence entries, part 1207.
1033. gbinv1208.seq - Invertebrate sequence entries, part 1208.
1034. gbinv1209.seq - Invertebrate sequence entries, part 1209.
1035. gbinv121.seq - Invertebrate sequence entries, part 121.
1036. gbinv1210.seq - Invertebrate sequence entries, part 1210.
1037. gbinv1211.seq - Invertebrate sequence entries, part 1211.
1038. gbinv1212.seq - Invertebrate sequence entries, part 1212.
1039. gbinv122.seq - Invertebrate sequence entries, part 122.
1040. gbinv123.seq - Invertebrate sequence entries, part 123.
1041. gbinv124.seq - Invertebrate sequence entries, part 124.
1042. gbinv125.seq - Invertebrate sequence entries, part 125.
1043. gbinv126.seq - Invertebrate sequence entries, part 126.
1044. gbinv127.seq - Invertebrate sequence entries, part 127.
1045. gbinv128.seq - Invertebrate sequence entries, part 128.
1046. gbinv129.seq - Invertebrate sequence entries, part 129.
1047. gbinv13.seq - Invertebrate sequence entries, part 13.
1048. gbinv130.seq - Invertebrate sequence entries, part 130.
1049. gbinv131.seq - Invertebrate sequence entries, part 131.
1050. gbinv132.seq - Invertebrate sequence entries, part 132.
1051. gbinv133.seq - Invertebrate sequence entries, part 133.
1052. gbinv134.seq - Invertebrate sequence entries, part 134.
1053. gbinv135.seq - Invertebrate sequence entries, part 135.
1054. gbinv136.seq - Invertebrate sequence entries, part 136.
1055. gbinv137.seq - Invertebrate sequence entries, part 137.
1056. gbinv138.seq - Invertebrate sequence entries, part 138.
1057. gbinv139.seq - Invertebrate sequence entries, part 139.
1058. gbinv14.seq - Invertebrate sequence entries, part 14.
1059. gbinv140.seq - Invertebrate sequence entries, part 140.
1060. gbinv141.seq - Invertebrate sequence entries, part 141.
1061. gbinv142.seq - Invertebrate sequence entries, part 142.
1062. gbinv143.seq - Invertebrate sequence entries, part 143.
1063. gbinv144.seq - Invertebrate sequence entries, part 144.
1064. gbinv145.seq - Invertebrate sequence entries, part 145.
1065. gbinv146.seq - Invertebrate sequence entries, part 146.
1066. gbinv147.seq - Invertebrate sequence entries, part 147.
1067. gbinv148.seq - Invertebrate sequence entries, part 148.
1068. gbinv149.seq - Invertebrate sequence entries, part 149.
1069. gbinv15.seq - Invertebrate sequence entries, part 15.
1070. gbinv150.seq - Invertebrate sequence entries, part 150.
1071. gbinv151.seq - Invertebrate sequence entries, part 151.
1072. gbinv152.seq - Invertebrate sequence entries, part 152.
1073. gbinv153.seq - Invertebrate sequence entries, part 153.
1074. gbinv154.seq - Invertebrate sequence entries, part 154.
1075. gbinv155.seq - Invertebrate sequence entries, part 155.
1076. gbinv156.seq - Invertebrate sequence entries, part 156.
1077. gbinv157.seq - Invertebrate sequence entries, part 157.
1078. gbinv158.seq - Invertebrate sequence entries, part 158.
1079. gbinv159.seq - Invertebrate sequence entries, part 159.
1080. gbinv16.seq - Invertebrate sequence entries, part 16.
1081. gbinv160.seq - Invertebrate sequence entries, part 160.
1082. gbinv161.seq - Invertebrate sequence entries, part 161.
1083. gbinv162.seq - Invertebrate sequence entries, part 162.
1084. gbinv163.seq - Invertebrate sequence entries, part 163.
1085. gbinv164.seq - Invertebrate sequence entries, part 164.
1086. gbinv165.seq - Invertebrate sequence entries, part 165.
1087. gbinv166.seq - Invertebrate sequence entries, part 166.
1088. gbinv167.seq - Invertebrate sequence entries, part 167.
1089. gbinv168.seq - Invertebrate sequence entries, part 168.
1090. gbinv169.seq - Invertebrate sequence entries, part 169.
1091. gbinv17.seq - Invertebrate sequence entries, part 17.
1092. gbinv170.seq - Invertebrate sequence entries, part 170.
1093. gbinv171.seq - Invertebrate sequence entries, part 171.
1094. gbinv172.seq - Invertebrate sequence entries, part 172.
1095. gbinv173.seq - Invertebrate sequence entries, part 173.
1096. gbinv174.seq - Invertebrate sequence entries, part 174.
1097. gbinv175.seq - Invertebrate sequence entries, part 175.
1098. gbinv176.seq - Invertebrate sequence entries, part 176.
1099. gbinv177.seq - Invertebrate sequence entries, part 177.
1100. gbinv178.seq - Invertebrate sequence entries, part 178.
1101. gbinv179.seq - Invertebrate sequence entries, part 179.
1102. gbinv18.seq - Invertebrate sequence entries, part 18.
1103. gbinv180.seq - Invertebrate sequence entries, part 180.
1104. gbinv181.seq - Invertebrate sequence entries, part 181.
1105. gbinv182.seq - Invertebrate sequence entries, part 182.
1106. gbinv183.seq - Invertebrate sequence entries, part 183.
1107. gbinv184.seq - Invertebrate sequence entries, part 184.
1108. gbinv185.seq - Invertebrate sequence entries, part 185.
1109. gbinv186.seq - Invertebrate sequence entries, part 186.
1110. gbinv187.seq - Invertebrate sequence entries, part 187.
1111. gbinv188.seq - Invertebrate sequence entries, part 188.
1112. gbinv189.seq - Invertebrate sequence entries, part 189.
1113. gbinv19.seq - Invertebrate sequence entries, part 19.
1114. gbinv190.seq - Invertebrate sequence entries, part 190.
1115. gbinv191.seq - Invertebrate sequence entries, part 191.
1116. gbinv192.seq - Invertebrate sequence entries, part 192.
1117. gbinv193.seq - Invertebrate sequence entries, part 193.
1118. gbinv194.seq - Invertebrate sequence entries, part 194.
1119. gbinv195.seq - Invertebrate sequence entries, part 195.
1120. gbinv196.seq - Invertebrate sequence entries, part 196.
1121. gbinv197.seq - Invertebrate sequence entries, part 197.
1122. gbinv198.seq - Invertebrate sequence entries, part 198.
1123. gbinv199.seq - Invertebrate sequence entries, part 199.
1124. gbinv2.seq - Invertebrate sequence entries, part 2.
1125. gbinv20.seq - Invertebrate sequence entries, part 20.
1126. gbinv200.seq - Invertebrate sequence entries, part 200.
1127. gbinv201.seq - Invertebrate sequence entries, part 201.
1128. gbinv202.seq - Invertebrate sequence entries, part 202.
1129. gbinv203.seq - Invertebrate sequence entries, part 203.
1130. gbinv204.seq - Invertebrate sequence entries, part 204.
1131. gbinv205.seq - Invertebrate sequence entries, part 205.
1132. gbinv206.seq - Invertebrate sequence entries, part 206.
1133. gbinv207.seq - Invertebrate sequence entries, part 207.
1134. gbinv208.seq - Invertebrate sequence entries, part 208.
1135. gbinv209.seq - Invertebrate sequence entries, part 209.
1136. gbinv21.seq - Invertebrate sequence entries, part 21.
1137. gbinv210.seq - Invertebrate sequence entries, part 210.
1138. gbinv211.seq - Invertebrate sequence entries, part 211.
1139. gbinv212.seq - Invertebrate sequence entries, part 212.
1140. gbinv213.seq - Invertebrate sequence entries, part 213.
1141. gbinv214.seq - Invertebrate sequence entries, part 214.
1142. gbinv215.seq - Invertebrate sequence entries, part 215.
1143. gbinv216.seq - Invertebrate sequence entries, part 216.
1144. gbinv217.seq - Invertebrate sequence entries, part 217.
1145. gbinv218.seq - Invertebrate sequence entries, part 218.
1146. gbinv219.seq - Invertebrate sequence entries, part 219.
1147. gbinv22.seq - Invertebrate sequence entries, part 22.
1148. gbinv220.seq - Invertebrate sequence entries, part 220.
1149. gbinv221.seq - Invertebrate sequence entries, part 221.
1150. gbinv222.seq - Invertebrate sequence entries, part 222.
1151. gbinv223.seq - Invertebrate sequence entries, part 223.
1152. gbinv224.seq - Invertebrate sequence entries, part 224.
1153. gbinv225.seq - Invertebrate sequence entries, part 225.
1154. gbinv226.seq - Invertebrate sequence entries, part 226.
1155. gbinv227.seq - Invertebrate sequence entries, part 227.
1156. gbinv228.seq - Invertebrate sequence entries, part 228.
1157. gbinv229.seq - Invertebrate sequence entries, part 229.
1158. gbinv23.seq - Invertebrate sequence entries, part 23.
1159. gbinv230.seq - Invertebrate sequence entries, part 230.
1160. gbinv231.seq - Invertebrate sequence entries, part 231.
1161. gbinv232.seq - Invertebrate sequence entries, part 232.
1162. gbinv233.seq - Invertebrate sequence entries, part 233.
1163. gbinv234.seq - Invertebrate sequence entries, part 234.
1164. gbinv235.seq - Invertebrate sequence entries, part 235.
1165. gbinv236.seq - Invertebrate sequence entries, part 236.
1166. gbinv237.seq - Invertebrate sequence entries, part 237.
1167. gbinv238.seq - Invertebrate sequence entries, part 238.
1168. gbinv239.seq - Invertebrate sequence entries, part 239.
1169. gbinv24.seq - Invertebrate sequence entries, part 24.
1170. gbinv240.seq - Invertebrate sequence entries, part 240.
1171. gbinv241.seq - Invertebrate sequence entries, part 241.
1172. gbinv242.seq - Invertebrate sequence entries, part 242.
1173. gbinv243.seq - Invertebrate sequence entries, part 243.
1174. gbinv244.seq - Invertebrate sequence entries, part 244.
1175. gbinv245.seq - Invertebrate sequence entries, part 245.
1176. gbinv246.seq - Invertebrate sequence entries, part 246.
1177. gbinv247.seq - Invertebrate sequence entries, part 247.
1178. gbinv248.seq - Invertebrate sequence entries, part 248.
1179. gbinv249.seq - Invertebrate sequence entries, part 249.
1180. gbinv25.seq - Invertebrate sequence entries, part 25.
1181. gbinv250.seq - Invertebrate sequence entries, part 250.
1182. gbinv251.seq - Invertebrate sequence entries, part 251.
1183. gbinv252.seq - Invertebrate sequence entries, part 252.
1184. gbinv253.seq - Invertebrate sequence entries, part 253.
1185. gbinv254.seq - Invertebrate sequence entries, part 254.
1186. gbinv255.seq - Invertebrate sequence entries, part 255.
1187. gbinv256.seq - Invertebrate sequence entries, part 256.
1188. gbinv257.seq - Invertebrate sequence entries, part 257.
1189. gbinv258.seq - Invertebrate sequence entries, part 258.
1190. gbinv259.seq - Invertebrate sequence entries, part 259.
1191. gbinv26.seq - Invertebrate sequence entries, part 26.
1192. gbinv260.seq - Invertebrate sequence entries, part 260.
1193. gbinv261.seq - Invertebrate sequence entries, part 261.
1194. gbinv262.seq - Invertebrate sequence entries, part 262.
1195. gbinv263.seq - Invertebrate sequence entries, part 263.
1196. gbinv264.seq - Invertebrate sequence entries, part 264.
1197. gbinv265.seq - Invertebrate sequence entries, part 265.
1198. gbinv266.seq - Invertebrate sequence entries, part 266.
1199. gbinv267.seq - Invertebrate sequence entries, part 267.
1200. gbinv268.seq - Invertebrate sequence entries, part 268.
1201. gbinv269.seq - Invertebrate sequence entries, part 269.
1202. gbinv27.seq - Invertebrate sequence entries, part 27.
1203. gbinv270.seq - Invertebrate sequence entries, part 270.
1204. gbinv271.seq - Invertebrate sequence entries, part 271.
1205. gbinv272.seq - Invertebrate sequence entries, part 272.
1206. gbinv273.seq - Invertebrate sequence entries, part 273.
1207. gbinv274.seq - Invertebrate sequence entries, part 274.
1208. gbinv275.seq - Invertebrate sequence entries, part 275.
1209. gbinv276.seq - Invertebrate sequence entries, part 276.
1210. gbinv277.seq - Invertebrate sequence entries, part 277.
1211. gbinv278.seq - Invertebrate sequence entries, part 278.
1212. gbinv279.seq - Invertebrate sequence entries, part 279.
1213. gbinv28.seq - Invertebrate sequence entries, part 28.
1214. gbinv280.seq - Invertebrate sequence entries, part 280.
1215. gbinv281.seq - Invertebrate sequence entries, part 281.
1216. gbinv282.seq - Invertebrate sequence entries, part 282.
1217. gbinv283.seq - Invertebrate sequence entries, part 283.
1218. gbinv284.seq - Invertebrate sequence entries, part 284.
1219. gbinv285.seq - Invertebrate sequence entries, part 285.
1220. gbinv286.seq - Invertebrate sequence entries, part 286.
1221. gbinv287.seq - Invertebrate sequence entries, part 287.
1222. gbinv288.seq - Invertebrate sequence entries, part 288.
1223. gbinv289.seq - Invertebrate sequence entries, part 289.
1224. gbinv29.seq - Invertebrate sequence entries, part 29.
1225. gbinv290.seq - Invertebrate sequence entries, part 290.
1226. gbinv291.seq - Invertebrate sequence entries, part 291.
1227. gbinv292.seq - Invertebrate sequence entries, part 292.
1228. gbinv293.seq - Invertebrate sequence entries, part 293.
1229. gbinv294.seq - Invertebrate sequence entries, part 294.
1230. gbinv295.seq - Invertebrate sequence entries, part 295.
1231. gbinv296.seq - Invertebrate sequence entries, part 296.
1232. gbinv297.seq - Invertebrate sequence entries, part 297.
1233. gbinv298.seq - Invertebrate sequence entries, part 298.
1234. gbinv299.seq - Invertebrate sequence entries, part 299.
1235. gbinv3.seq - Invertebrate sequence entries, part 3.
1236. gbinv30.seq - Invertebrate sequence entries, part 30.
1237. gbinv300.seq - Invertebrate sequence entries, part 300.
1238. gbinv301.seq - Invertebrate sequence entries, part 301.
1239. gbinv302.seq - Invertebrate sequence entries, part 302.
1240. gbinv303.seq - Invertebrate sequence entries, part 303.
1241. gbinv304.seq - Invertebrate sequence entries, part 304.
1242. gbinv305.seq - Invertebrate sequence entries, part 305.
1243. gbinv306.seq - Invertebrate sequence entries, part 306.
1244. gbinv307.seq - Invertebrate sequence entries, part 307.
1245. gbinv308.seq - Invertebrate sequence entries, part 308.
1246. gbinv309.seq - Invertebrate sequence entries, part 309.
1247. gbinv31.seq - Invertebrate sequence entries, part 31.
1248. gbinv310.seq - Invertebrate sequence entries, part 310.
1249. gbinv311.seq - Invertebrate sequence entries, part 311.
1250. gbinv312.seq - Invertebrate sequence entries, part 312.
1251. gbinv313.seq - Invertebrate sequence entries, part 313.
1252. gbinv314.seq - Invertebrate sequence entries, part 314.
1253. gbinv315.seq - Invertebrate sequence entries, part 315.
1254. gbinv316.seq - Invertebrate sequence entries, part 316.
1255. gbinv317.seq - Invertebrate sequence entries, part 317.
1256. gbinv318.seq - Invertebrate sequence entries, part 318.
1257. gbinv319.seq - Invertebrate sequence entries, part 319.
1258. gbinv32.seq - Invertebrate sequence entries, part 32.
1259. gbinv320.seq - Invertebrate sequence entries, part 320.
1260. gbinv321.seq - Invertebrate sequence entries, part 321.
1261. gbinv322.seq - Invertebrate sequence entries, part 322.
1262. gbinv323.seq - Invertebrate sequence entries, part 323.
1263. gbinv324.seq - Invertebrate sequence entries, part 324.
1264. gbinv325.seq - Invertebrate sequence entries, part 325.
1265. gbinv326.seq - Invertebrate sequence entries, part 326.
1266. gbinv327.seq - Invertebrate sequence entries, part 327.
1267. gbinv328.seq - Invertebrate sequence entries, part 328.
1268. gbinv329.seq - Invertebrate sequence entries, part 329.
1269. gbinv33.seq - Invertebrate sequence entries, part 33.
1270. gbinv330.seq - Invertebrate sequence entries, part 330.
1271. gbinv331.seq - Invertebrate sequence entries, part 331.
1272. gbinv332.seq - Invertebrate sequence entries, part 332.
1273. gbinv333.seq - Invertebrate sequence entries, part 333.
1274. gbinv334.seq - Invertebrate sequence entries, part 334.
1275. gbinv335.seq - Invertebrate sequence entries, part 335.
1276. gbinv336.seq - Invertebrate sequence entries, part 336.
1277. gbinv337.seq - Invertebrate sequence entries, part 337.
1278. gbinv338.seq - Invertebrate sequence entries, part 338.
1279. gbinv339.seq - Invertebrate sequence entries, part 339.
1280. gbinv34.seq - Invertebrate sequence entries, part 34.
1281. gbinv340.seq - Invertebrate sequence entries, part 340.
1282. gbinv341.seq - Invertebrate sequence entries, part 341.
1283. gbinv342.seq - Invertebrate sequence entries, part 342.
1284. gbinv343.seq - Invertebrate sequence entries, part 343.
1285. gbinv344.seq - Invertebrate sequence entries, part 344.
1286. gbinv345.seq - Invertebrate sequence entries, part 345.
1287. gbinv346.seq - Invertebrate sequence entries, part 346.
1288. gbinv347.seq - Invertebrate sequence entries, part 347.
1289. gbinv348.seq - Invertebrate sequence entries, part 348.
1290. gbinv349.seq - Invertebrate sequence entries, part 349.
1291. gbinv35.seq - Invertebrate sequence entries, part 35.
1292. gbinv350.seq - Invertebrate sequence entries, part 350.
1293. gbinv351.seq - Invertebrate sequence entries, part 351.
1294. gbinv352.seq - Invertebrate sequence entries, part 352.
1295. gbinv353.seq - Invertebrate sequence entries, part 353.
1296. gbinv354.seq - Invertebrate sequence entries, part 354.
1297. gbinv355.seq - Invertebrate sequence entries, part 355.
1298. gbinv356.seq - Invertebrate sequence entries, part 356.
1299. gbinv357.seq - Invertebrate sequence entries, part 357.
1300. gbinv358.seq - Invertebrate sequence entries, part 358.
1301. gbinv359.seq - Invertebrate sequence entries, part 359.
1302. gbinv36.seq - Invertebrate sequence entries, part 36.
1303. gbinv360.seq - Invertebrate sequence entries, part 360.
1304. gbinv361.seq - Invertebrate sequence entries, part 361.
1305. gbinv362.seq - Invertebrate sequence entries, part 362.
1306. gbinv363.seq - Invertebrate sequence entries, part 363.
1307. gbinv364.seq - Invertebrate sequence entries, part 364.
1308. gbinv365.seq - Invertebrate sequence entries, part 365.
1309. gbinv366.seq - Invertebrate sequence entries, part 366.
1310. gbinv367.seq - Invertebrate sequence entries, part 367.
1311. gbinv368.seq - Invertebrate sequence entries, part 368.
1312. gbinv369.seq - Invertebrate sequence entries, part 369.
1313. gbinv37.seq - Invertebrate sequence entries, part 37.
1314. gbinv370.seq - Invertebrate sequence entries, part 370.
1315. gbinv371.seq - Invertebrate sequence entries, part 371.
1316. gbinv372.seq - Invertebrate sequence entries, part 372.
1317. gbinv373.seq - Invertebrate sequence entries, part 373.
1318. gbinv374.seq - Invertebrate sequence entries, part 374.
1319. gbinv375.seq - Invertebrate sequence entries, part 375.
1320. gbinv376.seq - Invertebrate sequence entries, part 376.
1321. gbinv377.seq - Invertebrate sequence entries, part 377.
1322. gbinv378.seq - Invertebrate sequence entries, part 378.
1323. gbinv379.seq - Invertebrate sequence entries, part 379.
1324. gbinv38.seq - Invertebrate sequence entries, part 38.
1325. gbinv380.seq - Invertebrate sequence entries, part 380.
1326. gbinv381.seq - Invertebrate sequence entries, part 381.
1327. gbinv382.seq - Invertebrate sequence entries, part 382.
1328. gbinv383.seq - Invertebrate sequence entries, part 383.
1329. gbinv384.seq - Invertebrate sequence entries, part 384.
1330. gbinv385.seq - Invertebrate sequence entries, part 385.
1331. gbinv386.seq - Invertebrate sequence entries, part 386.
1332. gbinv387.seq - Invertebrate sequence entries, part 387.
1333. gbinv388.seq - Invertebrate sequence entries, part 388.
1334. gbinv389.seq - Invertebrate sequence entries, part 389.
1335. gbinv39.seq - Invertebrate sequence entries, part 39.
1336. gbinv390.seq - Invertebrate sequence entries, part 390.
1337. gbinv391.seq - Invertebrate sequence entries, part 391.
1338. gbinv392.seq - Invertebrate sequence entries, part 392.
1339. gbinv393.seq - Invertebrate sequence entries, part 393.
1340. gbinv394.seq - Invertebrate sequence entries, part 394.
1341. gbinv395.seq - Invertebrate sequence entries, part 395.
1342. gbinv396.seq - Invertebrate sequence entries, part 396.
1343. gbinv397.seq - Invertebrate sequence entries, part 397.
1344. gbinv398.seq - Invertebrate sequence entries, part 398.
1345. gbinv399.seq - Invertebrate sequence entries, part 399.
1346. gbinv4.seq - Invertebrate sequence entries, part 4.
1347. gbinv40.seq - Invertebrate sequence entries, part 40.
1348. gbinv400.seq - Invertebrate sequence entries, part 400.
1349. gbinv401.seq - Invertebrate sequence entries, part 401.
1350. gbinv402.seq - Invertebrate sequence entries, part 402.
1351. gbinv403.seq - Invertebrate sequence entries, part 403.
1352. gbinv404.seq - Invertebrate sequence entries, part 404.
1353. gbinv405.seq - Invertebrate sequence entries, part 405.
1354. gbinv406.seq - Invertebrate sequence entries, part 406.
1355. gbinv407.seq - Invertebrate sequence entries, part 407.
1356. gbinv408.seq - Invertebrate sequence entries, part 408.
1357. gbinv409.seq - Invertebrate sequence entries, part 409.
1358. gbinv41.seq - Invertebrate sequence entries, part 41.
1359. gbinv410.seq - Invertebrate sequence entries, part 410.
1360. gbinv411.seq - Invertebrate sequence entries, part 411.
1361. gbinv412.seq - Invertebrate sequence entries, part 412.
1362. gbinv413.seq - Invertebrate sequence entries, part 413.
1363. gbinv414.seq - Invertebrate sequence entries, part 414.
1364. gbinv415.seq - Invertebrate sequence entries, part 415.
1365. gbinv416.seq - Invertebrate sequence entries, part 416.
1366. gbinv417.seq - Invertebrate sequence entries, part 417.
1367. gbinv418.seq - Invertebrate sequence entries, part 418.
1368. gbinv419.seq - Invertebrate sequence entries, part 419.
1369. gbinv42.seq - Invertebrate sequence entries, part 42.
1370. gbinv420.seq - Invertebrate sequence entries, part 420.
1371. gbinv421.seq - Invertebrate sequence entries, part 421.
1372. gbinv422.seq - Invertebrate sequence entries, part 422.
1373. gbinv423.seq - Invertebrate sequence entries, part 423.
1374. gbinv424.seq - Invertebrate sequence entries, part 424.
1375. gbinv425.seq - Invertebrate sequence entries, part 425.
1376. gbinv426.seq - Invertebrate sequence entries, part 426.
1377. gbinv427.seq - Invertebrate sequence entries, part 427.
1378. gbinv428.seq - Invertebrate sequence entries, part 428.
1379. gbinv429.seq - Invertebrate sequence entries, part 429.
1380. gbinv43.seq - Invertebrate sequence entries, part 43.
1381. gbinv430.seq - Invertebrate sequence entries, part 430.
1382. gbinv431.seq - Invertebrate sequence entries, part 431.
1383. gbinv432.seq - Invertebrate sequence entries, part 432.
1384. gbinv433.seq - Invertebrate sequence entries, part 433.
1385. gbinv434.seq - Invertebrate sequence entries, part 434.
1386. gbinv435.seq - Invertebrate sequence entries, part 435.
1387. gbinv436.seq - Invertebrate sequence entries, part 436.
1388. gbinv437.seq - Invertebrate sequence entries, part 437.
1389. gbinv438.seq - Invertebrate sequence entries, part 438.
1390. gbinv439.seq - Invertebrate sequence entries, part 439.
1391. gbinv44.seq - Invertebrate sequence entries, part 44.
1392. gbinv440.seq - Invertebrate sequence entries, part 440.
1393. gbinv441.seq - Invertebrate sequence entries, part 441.
1394. gbinv442.seq - Invertebrate sequence entries, part 442.
1395. gbinv443.seq - Invertebrate sequence entries, part 443.
1396. gbinv444.seq - Invertebrate sequence entries, part 444.
1397. gbinv445.seq - Invertebrate sequence entries, part 445.
1398. gbinv446.seq - Invertebrate sequence entries, part 446.
1399. gbinv447.seq - Invertebrate sequence entries, part 447.
1400. gbinv448.seq - Invertebrate sequence entries, part 448.
1401. gbinv449.seq - Invertebrate sequence entries, part 449.
1402. gbinv45.seq - Invertebrate sequence entries, part 45.
1403. gbinv450.seq - Invertebrate sequence entries, part 450.
1404. gbinv451.seq - Invertebrate sequence entries, part 451.
1405. gbinv452.seq - Invertebrate sequence entries, part 452.
1406. gbinv453.seq - Invertebrate sequence entries, part 453.
1407. gbinv454.seq - Invertebrate sequence entries, part 454.
1408. gbinv455.seq - Invertebrate sequence entries, part 455.
1409. gbinv456.seq - Invertebrate sequence entries, part 456.
1410. gbinv457.seq - Invertebrate sequence entries, part 457.
1411. gbinv458.seq - Invertebrate sequence entries, part 458.
1412. gbinv459.seq - Invertebrate sequence entries, part 459.
1413. gbinv46.seq - Invertebrate sequence entries, part 46.
1414. gbinv460.seq - Invertebrate sequence entries, part 460.
1415. gbinv461.seq - Invertebrate sequence entries, part 461.
1416. gbinv462.seq - Invertebrate sequence entries, part 462.
1417. gbinv463.seq - Invertebrate sequence entries, part 463.
1418. gbinv464.seq - Invertebrate sequence entries, part 464.
1419. gbinv465.seq - Invertebrate sequence entries, part 465.
1420. gbinv466.seq - Invertebrate sequence entries, part 466.
1421. gbinv467.seq - Invertebrate sequence entries, part 467.
1422. gbinv468.seq - Invertebrate sequence entries, part 468.
1423. gbinv469.seq - Invertebrate sequence entries, part 469.
1424. gbinv47.seq - Invertebrate sequence entries, part 47.
1425. gbinv470.seq - Invertebrate sequence entries, part 470.
1426. gbinv471.seq - Invertebrate sequence entries, part 471.
1427. gbinv472.seq - Invertebrate sequence entries, part 472.
1428. gbinv473.seq - Invertebrate sequence entries, part 473.
1429. gbinv474.seq - Invertebrate sequence entries, part 474.
1430. gbinv475.seq - Invertebrate sequence entries, part 475.
1431. gbinv476.seq - Invertebrate sequence entries, part 476.
1432. gbinv477.seq - Invertebrate sequence entries, part 477.
1433. gbinv478.seq - Invertebrate sequence entries, part 478.
1434. gbinv479.seq - Invertebrate sequence entries, part 479.
1435. gbinv48.seq - Invertebrate sequence entries, part 48.
1436. gbinv480.seq - Invertebrate sequence entries, part 480.
1437. gbinv481.seq - Invertebrate sequence entries, part 481.
1438. gbinv482.seq - Invertebrate sequence entries, part 482.
1439. gbinv483.seq - Invertebrate sequence entries, part 483.
1440. gbinv484.seq - Invertebrate sequence entries, part 484.
1441. gbinv485.seq - Invertebrate sequence entries, part 485.
1442. gbinv486.seq - Invertebrate sequence entries, part 486.
1443. gbinv487.seq - Invertebrate sequence entries, part 487.
1444. gbinv488.seq - Invertebrate sequence entries, part 488.
1445. gbinv489.seq - Invertebrate sequence entries, part 489.
1446. gbinv49.seq - Invertebrate sequence entries, part 49.
1447. gbinv490.seq - Invertebrate sequence entries, part 490.
1448. gbinv491.seq - Invertebrate sequence entries, part 491.
1449. gbinv492.seq - Invertebrate sequence entries, part 492.
1450. gbinv493.seq - Invertebrate sequence entries, part 493.
1451. gbinv494.seq - Invertebrate sequence entries, part 494.
1452. gbinv495.seq - Invertebrate sequence entries, part 495.
1453. gbinv496.seq - Invertebrate sequence entries, part 496.
1454. gbinv497.seq - Invertebrate sequence entries, part 497.
1455. gbinv498.seq - Invertebrate sequence entries, part 498.
1456. gbinv499.seq - Invertebrate sequence entries, part 499.
1457. gbinv5.seq - Invertebrate sequence entries, part 5.
1458. gbinv50.seq - Invertebrate sequence entries, part 50.
1459. gbinv500.seq - Invertebrate sequence entries, part 500.
1460. gbinv501.seq - Invertebrate sequence entries, part 501.
1461. gbinv502.seq - Invertebrate sequence entries, part 502.
1462. gbinv503.seq - Invertebrate sequence entries, part 503.
1463. gbinv504.seq - Invertebrate sequence entries, part 504.
1464. gbinv505.seq - Invertebrate sequence entries, part 505.
1465. gbinv506.seq - Invertebrate sequence entries, part 506.
1466. gbinv507.seq - Invertebrate sequence entries, part 507.
1467. gbinv508.seq - Invertebrate sequence entries, part 508.
1468. gbinv509.seq - Invertebrate sequence entries, part 509.
1469. gbinv51.seq - Invertebrate sequence entries, part 51.
1470. gbinv510.seq - Invertebrate sequence entries, part 510.
1471. gbinv511.seq - Invertebrate sequence entries, part 511.
1472. gbinv512.seq - Invertebrate sequence entries, part 512.
1473. gbinv513.seq - Invertebrate sequence entries, part 513.
1474. gbinv514.seq - Invertebrate sequence entries, part 514.
1475. gbinv515.seq - Invertebrate sequence entries, part 515.
1476. gbinv516.seq - Invertebrate sequence entries, part 516.
1477. gbinv517.seq - Invertebrate sequence entries, part 517.
1478. gbinv518.seq - Invertebrate sequence entries, part 518.
1479. gbinv519.seq - Invertebrate sequence entries, part 519.
1480. gbinv52.seq - Invertebrate sequence entries, part 52.
1481. gbinv520.seq - Invertebrate sequence entries, part 520.
1482. gbinv521.seq - Invertebrate sequence entries, part 521.
1483. gbinv522.seq - Invertebrate sequence entries, part 522.
1484. gbinv523.seq - Invertebrate sequence entries, part 523.
1485. gbinv524.seq - Invertebrate sequence entries, part 524.
1486. gbinv525.seq - Invertebrate sequence entries, part 525.
1487. gbinv526.seq - Invertebrate sequence entries, part 526.
1488. gbinv527.seq - Invertebrate sequence entries, part 527.
1489. gbinv528.seq - Invertebrate sequence entries, part 528.
1490. gbinv529.seq - Invertebrate sequence entries, part 529.
1491. gbinv53.seq - Invertebrate sequence entries, part 53.
1492. gbinv530.seq - Invertebrate sequence entries, part 530.
1493. gbinv531.seq - Invertebrate sequence entries, part 531.
1494. gbinv532.seq - Invertebrate sequence entries, part 532.
1495. gbinv533.seq - Invertebrate sequence entries, part 533.
1496. gbinv534.seq - Invertebrate sequence entries, part 534.
1497. gbinv535.seq - Invertebrate sequence entries, part 535.
1498. gbinv536.seq - Invertebrate sequence entries, part 536.
1499. gbinv537.seq - Invertebrate sequence entries, part 537.
1500. gbinv538.seq - Invertebrate sequence entries, part 538.
1501. gbinv539.seq - Invertebrate sequence entries, part 539.
1502. gbinv54.seq - Invertebrate sequence entries, part 54.
1503. gbinv540.seq - Invertebrate sequence entries, part 540.
1504. gbinv541.seq - Invertebrate sequence entries, part 541.
1505. gbinv542.seq - Invertebrate sequence entries, part 542.
1506. gbinv543.seq - Invertebrate sequence entries, part 543.
1507. gbinv544.seq - Invertebrate sequence entries, part 544.
1508. gbinv545.seq - Invertebrate sequence entries, part 545.
1509. gbinv546.seq - Invertebrate sequence entries, part 546.
1510. gbinv547.seq - Invertebrate sequence entries, part 547.
1511. gbinv548.seq - Invertebrate sequence entries, part 548.
1512. gbinv549.seq - Invertebrate sequence entries, part 549.
1513. gbinv55.seq - Invertebrate sequence entries, part 55.
1514. gbinv550.seq - Invertebrate sequence entries, part 550.
1515. gbinv551.seq - Invertebrate sequence entries, part 551.
1516. gbinv552.seq - Invertebrate sequence entries, part 552.
1517. gbinv553.seq - Invertebrate sequence entries, part 553.
1518. gbinv554.seq - Invertebrate sequence entries, part 554.
1519. gbinv555.seq - Invertebrate sequence entries, part 555.
1520. gbinv556.seq - Invertebrate sequence entries, part 556.
1521. gbinv557.seq - Invertebrate sequence entries, part 557.
1522. gbinv558.seq - Invertebrate sequence entries, part 558.
1523. gbinv559.seq - Invertebrate sequence entries, part 559.
1524. gbinv56.seq - Invertebrate sequence entries, part 56.
1525. gbinv560.seq - Invertebrate sequence entries, part 560.
1526. gbinv561.seq - Invertebrate sequence entries, part 561.
1527. gbinv562.seq - Invertebrate sequence entries, part 562.
1528. gbinv563.seq - Invertebrate sequence entries, part 563.
1529. gbinv564.seq - Invertebrate sequence entries, part 564.
1530. gbinv565.seq - Invertebrate sequence entries, part 565.
1531. gbinv566.seq - Invertebrate sequence entries, part 566.
1532. gbinv567.seq - Invertebrate sequence entries, part 567.
1533. gbinv568.seq - Invertebrate sequence entries, part 568.
1534. gbinv569.seq - Invertebrate sequence entries, part 569.
1535. gbinv57.seq - Invertebrate sequence entries, part 57.
1536. gbinv570.seq - Invertebrate sequence entries, part 570.
1537. gbinv571.seq - Invertebrate sequence entries, part 571.
1538. gbinv572.seq - Invertebrate sequence entries, part 572.
1539. gbinv573.seq - Invertebrate sequence entries, part 573.
1540. gbinv574.seq - Invertebrate sequence entries, part 574.
1541. gbinv575.seq - Invertebrate sequence entries, part 575.
1542. gbinv576.seq - Invertebrate sequence entries, part 576.
1543. gbinv577.seq - Invertebrate sequence entries, part 577.
1544. gbinv578.seq - Invertebrate sequence entries, part 578.
1545. gbinv579.seq - Invertebrate sequence entries, part 579.
1546. gbinv58.seq - Invertebrate sequence entries, part 58.
1547. gbinv580.seq - Invertebrate sequence entries, part 580.
1548. gbinv581.seq - Invertebrate sequence entries, part 581.
1549. gbinv582.seq - Invertebrate sequence entries, part 582.
1550. gbinv583.seq - Invertebrate sequence entries, part 583.
1551. gbinv584.seq - Invertebrate sequence entries, part 584.
1552. gbinv585.seq - Invertebrate sequence entries, part 585.
1553. gbinv586.seq - Invertebrate sequence entries, part 586.
1554. gbinv587.seq - Invertebrate sequence entries, part 587.
1555. gbinv588.seq - Invertebrate sequence entries, part 588.
1556. gbinv589.seq - Invertebrate sequence entries, part 589.
1557. gbinv59.seq - Invertebrate sequence entries, part 59.
1558. gbinv590.seq - Invertebrate sequence entries, part 590.
1559. gbinv591.seq - Invertebrate sequence entries, part 591.
1560. gbinv592.seq - Invertebrate sequence entries, part 592.
1561. gbinv593.seq - Invertebrate sequence entries, part 593.
1562. gbinv594.seq - Invertebrate sequence entries, part 594.
1563. gbinv595.seq - Invertebrate sequence entries, part 595.
1564. gbinv596.seq - Invertebrate sequence entries, part 596.
1565. gbinv597.seq - Invertebrate sequence entries, part 597.
1566. gbinv598.seq - Invertebrate sequence entries, part 598.
1567. gbinv599.seq - Invertebrate sequence entries, part 599.
1568. gbinv6.seq - Invertebrate sequence entries, part 6.
1569. gbinv60.seq - Invertebrate sequence entries, part 60.
1570. gbinv600.seq - Invertebrate sequence entries, part 600.
1571. gbinv601.seq - Invertebrate sequence entries, part 601.
1572. gbinv602.seq - Invertebrate sequence entries, part 602.
1573. gbinv603.seq - Invertebrate sequence entries, part 603.
1574. gbinv604.seq - Invertebrate sequence entries, part 604.
1575. gbinv605.seq - Invertebrate sequence entries, part 605.
1576. gbinv606.seq - Invertebrate sequence entries, part 606.
1577. gbinv607.seq - Invertebrate sequence entries, part 607.
1578. gbinv608.seq - Invertebrate sequence entries, part 608.
1579. gbinv609.seq - Invertebrate sequence entries, part 609.
1580. gbinv61.seq - Invertebrate sequence entries, part 61.
1581. gbinv610.seq - Invertebrate sequence entries, part 610.
1582. gbinv611.seq - Invertebrate sequence entries, part 611.
1583. gbinv612.seq - Invertebrate sequence entries, part 612.
1584. gbinv613.seq - Invertebrate sequence entries, part 613.
1585. gbinv614.seq - Invertebrate sequence entries, part 614.
1586. gbinv615.seq - Invertebrate sequence entries, part 615.
1587. gbinv616.seq - Invertebrate sequence entries, part 616.
1588. gbinv617.seq - Invertebrate sequence entries, part 617.
1589. gbinv618.seq - Invertebrate sequence entries, part 618.
1590. gbinv619.seq - Invertebrate sequence entries, part 619.
1591. gbinv62.seq - Invertebrate sequence entries, part 62.
1592. gbinv620.seq - Invertebrate sequence entries, part 620.
1593. gbinv621.seq - Invertebrate sequence entries, part 621.
1594. gbinv622.seq - Invertebrate sequence entries, part 622.
1595. gbinv623.seq - Invertebrate sequence entries, part 623.
1596. gbinv624.seq - Invertebrate sequence entries, part 624.
1597. gbinv625.seq - Invertebrate sequence entries, part 625.
1598. gbinv626.seq - Invertebrate sequence entries, part 626.
1599. gbinv627.seq - Invertebrate sequence entries, part 627.
1600. gbinv628.seq - Invertebrate sequence entries, part 628.
1601. gbinv629.seq - Invertebrate sequence entries, part 629.
1602. gbinv63.seq - Invertebrate sequence entries, part 63.
1603. gbinv630.seq - Invertebrate sequence entries, part 630.
1604. gbinv631.seq - Invertebrate sequence entries, part 631.
1605. gbinv632.seq - Invertebrate sequence entries, part 632.
1606. gbinv633.seq - Invertebrate sequence entries, part 633.
1607. gbinv634.seq - Invertebrate sequence entries, part 634.
1608. gbinv635.seq - Invertebrate sequence entries, part 635.
1609. gbinv636.seq - Invertebrate sequence entries, part 636.
1610. gbinv637.seq - Invertebrate sequence entries, part 637.
1611. gbinv638.seq - Invertebrate sequence entries, part 638.
1612. gbinv639.seq - Invertebrate sequence entries, part 639.
1613. gbinv64.seq - Invertebrate sequence entries, part 64.
1614. gbinv640.seq - Invertebrate sequence entries, part 640.
1615. gbinv641.seq - Invertebrate sequence entries, part 641.
1616. gbinv642.seq - Invertebrate sequence entries, part 642.
1617. gbinv643.seq - Invertebrate sequence entries, part 643.
1618. gbinv644.seq - Invertebrate sequence entries, part 644.
1619. gbinv645.seq - Invertebrate sequence entries, part 645.
1620. gbinv646.seq - Invertebrate sequence entries, part 646.
1621. gbinv647.seq - Invertebrate sequence entries, part 647.
1622. gbinv648.seq - Invertebrate sequence entries, part 648.
1623. gbinv649.seq - Invertebrate sequence entries, part 649.
1624. gbinv65.seq - Invertebrate sequence entries, part 65.
1625. gbinv650.seq - Invertebrate sequence entries, part 650.
1626. gbinv651.seq - Invertebrate sequence entries, part 651.
1627. gbinv652.seq - Invertebrate sequence entries, part 652.
1628. gbinv653.seq - Invertebrate sequence entries, part 653.
1629. gbinv654.seq - Invertebrate sequence entries, part 654.
1630. gbinv655.seq - Invertebrate sequence entries, part 655.
1631. gbinv656.seq - Invertebrate sequence entries, part 656.
1632. gbinv657.seq - Invertebrate sequence entries, part 657.
1633. gbinv658.seq - Invertebrate sequence entries, part 658.
1634. gbinv659.seq - Invertebrate sequence entries, part 659.
1635. gbinv66.seq - Invertebrate sequence entries, part 66.
1636. gbinv660.seq - Invertebrate sequence entries, part 660.
1637. gbinv661.seq - Invertebrate sequence entries, part 661.
1638. gbinv662.seq - Invertebrate sequence entries, part 662.
1639. gbinv663.seq - Invertebrate sequence entries, part 663.
1640. gbinv664.seq - Invertebrate sequence entries, part 664.
1641. gbinv665.seq - Invertebrate sequence entries, part 665.
1642. gbinv666.seq - Invertebrate sequence entries, part 666.
1643. gbinv667.seq - Invertebrate sequence entries, part 667.
1644. gbinv668.seq - Invertebrate sequence entries, part 668.
1645. gbinv669.seq - Invertebrate sequence entries, part 669.
1646. gbinv67.seq - Invertebrate sequence entries, part 67.
1647. gbinv670.seq - Invertebrate sequence entries, part 670.
1648. gbinv671.seq - Invertebrate sequence entries, part 671.
1649. gbinv672.seq - Invertebrate sequence entries, part 672.
1650. gbinv673.seq - Invertebrate sequence entries, part 673.
1651. gbinv674.seq - Invertebrate sequence entries, part 674.
1652. gbinv675.seq - Invertebrate sequence entries, part 675.
1653. gbinv676.seq - Invertebrate sequence entries, part 676.
1654. gbinv677.seq - Invertebrate sequence entries, part 677.
1655. gbinv678.seq - Invertebrate sequence entries, part 678.
1656. gbinv679.seq - Invertebrate sequence entries, part 679.
1657. gbinv68.seq - Invertebrate sequence entries, part 68.
1658. gbinv680.seq - Invertebrate sequence entries, part 680.
1659. gbinv681.seq - Invertebrate sequence entries, part 681.
1660. gbinv682.seq - Invertebrate sequence entries, part 682.
1661. gbinv683.seq - Invertebrate sequence entries, part 683.
1662. gbinv684.seq - Invertebrate sequence entries, part 684.
1663. gbinv685.seq - Invertebrate sequence entries, part 685.
1664. gbinv686.seq - Invertebrate sequence entries, part 686.
1665. gbinv687.seq - Invertebrate sequence entries, part 687.
1666. gbinv688.seq - Invertebrate sequence entries, part 688.
1667. gbinv689.seq - Invertebrate sequence entries, part 689.
1668. gbinv69.seq - Invertebrate sequence entries, part 69.
1669. gbinv690.seq - Invertebrate sequence entries, part 690.
1670. gbinv691.seq - Invertebrate sequence entries, part 691.
1671. gbinv692.seq - Invertebrate sequence entries, part 692.
1672. gbinv693.seq - Invertebrate sequence entries, part 693.
1673. gbinv694.seq - Invertebrate sequence entries, part 694.
1674. gbinv695.seq - Invertebrate sequence entries, part 695.
1675. gbinv696.seq - Invertebrate sequence entries, part 696.
1676. gbinv697.seq - Invertebrate sequence entries, part 697.
1677. gbinv698.seq - Invertebrate sequence entries, part 698.
1678. gbinv699.seq - Invertebrate sequence entries, part 699.
1679. gbinv7.seq - Invertebrate sequence entries, part 7.
1680. gbinv70.seq - Invertebrate sequence entries, part 70.
1681. gbinv700.seq - Invertebrate sequence entries, part 700.
1682. gbinv701.seq - Invertebrate sequence entries, part 701.
1683. gbinv702.seq - Invertebrate sequence entries, part 702.
1684. gbinv703.seq - Invertebrate sequence entries, part 703.
1685. gbinv704.seq - Invertebrate sequence entries, part 704.
1686. gbinv705.seq - Invertebrate sequence entries, part 705.
1687. gbinv706.seq - Invertebrate sequence entries, part 706.
1688. gbinv707.seq - Invertebrate sequence entries, part 707.
1689. gbinv708.seq - Invertebrate sequence entries, part 708.
1690. gbinv709.seq - Invertebrate sequence entries, part 709.
1691. gbinv71.seq - Invertebrate sequence entries, part 71.
1692. gbinv710.seq - Invertebrate sequence entries, part 710.
1693. gbinv711.seq - Invertebrate sequence entries, part 711.
1694. gbinv712.seq - Invertebrate sequence entries, part 712.
1695. gbinv713.seq - Invertebrate sequence entries, part 713.
1696. gbinv714.seq - Invertebrate sequence entries, part 714.
1697. gbinv715.seq - Invertebrate sequence entries, part 715.
1698. gbinv716.seq - Invertebrate sequence entries, part 716.
1699. gbinv717.seq - Invertebrate sequence entries, part 717.
1700. gbinv718.seq - Invertebrate sequence entries, part 718.
1701. gbinv719.seq - Invertebrate sequence entries, part 719.
1702. gbinv72.seq - Invertebrate sequence entries, part 72.
1703. gbinv720.seq - Invertebrate sequence entries, part 720.
1704. gbinv721.seq - Invertebrate sequence entries, part 721.
1705. gbinv722.seq - Invertebrate sequence entries, part 722.
1706. gbinv723.seq - Invertebrate sequence entries, part 723.
1707. gbinv724.seq - Invertebrate sequence entries, part 724.
1708. gbinv725.seq - Invertebrate sequence entries, part 725.
1709. gbinv726.seq - Invertebrate sequence entries, part 726.
1710. gbinv727.seq - Invertebrate sequence entries, part 727.
1711. gbinv728.seq - Invertebrate sequence entries, part 728.
1712. gbinv729.seq - Invertebrate sequence entries, part 729.
1713. gbinv73.seq - Invertebrate sequence entries, part 73.
1714. gbinv730.seq - Invertebrate sequence entries, part 730.
1715. gbinv731.seq - Invertebrate sequence entries, part 731.
1716. gbinv732.seq - Invertebrate sequence entries, part 732.
1717. gbinv733.seq - Invertebrate sequence entries, part 733.
1718. gbinv734.seq - Invertebrate sequence entries, part 734.
1719. gbinv735.seq - Invertebrate sequence entries, part 735.
1720. gbinv736.seq - Invertebrate sequence entries, part 736.
1721. gbinv737.seq - Invertebrate sequence entries, part 737.
1722. gbinv738.seq - Invertebrate sequence entries, part 738.
1723. gbinv739.seq - Invertebrate sequence entries, part 739.
1724. gbinv74.seq - Invertebrate sequence entries, part 74.
1725. gbinv740.seq - Invertebrate sequence entries, part 740.
1726. gbinv741.seq - Invertebrate sequence entries, part 741.
1727. gbinv742.seq - Invertebrate sequence entries, part 742.
1728. gbinv743.seq - Invertebrate sequence entries, part 743.
1729. gbinv744.seq - Invertebrate sequence entries, part 744.
1730. gbinv745.seq - Invertebrate sequence entries, part 745.
1731. gbinv746.seq - Invertebrate sequence entries, part 746.
1732. gbinv747.seq - Invertebrate sequence entries, part 747.
1733. gbinv748.seq - Invertebrate sequence entries, part 748.
1734. gbinv749.seq - Invertebrate sequence entries, part 749.
1735. gbinv75.seq - Invertebrate sequence entries, part 75.
1736. gbinv750.seq - Invertebrate sequence entries, part 750.
1737. gbinv751.seq - Invertebrate sequence entries, part 751.
1738. gbinv752.seq - Invertebrate sequence entries, part 752.
1739. gbinv753.seq - Invertebrate sequence entries, part 753.
1740. gbinv754.seq - Invertebrate sequence entries, part 754.
1741. gbinv755.seq - Invertebrate sequence entries, part 755.
1742. gbinv756.seq - Invertebrate sequence entries, part 756.
1743. gbinv757.seq - Invertebrate sequence entries, part 757.
1744. gbinv758.seq - Invertebrate sequence entries, part 758.
1745. gbinv759.seq - Invertebrate sequence entries, part 759.
1746. gbinv76.seq - Invertebrate sequence entries, part 76.
1747. gbinv760.seq - Invertebrate sequence entries, part 760.
1748. gbinv761.seq - Invertebrate sequence entries, part 761.
1749. gbinv762.seq - Invertebrate sequence entries, part 762.
1750. gbinv763.seq - Invertebrate sequence entries, part 763.
1751. gbinv764.seq - Invertebrate sequence entries, part 764.
1752. gbinv765.seq - Invertebrate sequence entries, part 765.
1753. gbinv766.seq - Invertebrate sequence entries, part 766.
1754. gbinv767.seq - Invertebrate sequence entries, part 767.
1755. gbinv768.seq - Invertebrate sequence entries, part 768.
1756. gbinv769.seq - Invertebrate sequence entries, part 769.
1757. gbinv77.seq - Invertebrate sequence entries, part 77.
1758. gbinv770.seq - Invertebrate sequence entries, part 770.
1759. gbinv771.seq - Invertebrate sequence entries, part 771.
1760. gbinv772.seq - Invertebrate sequence entries, part 772.
1761. gbinv773.seq - Invertebrate sequence entries, part 773.
1762. gbinv774.seq - Invertebrate sequence entries, part 774.
1763. gbinv775.seq - Invertebrate sequence entries, part 775.
1764. gbinv776.seq - Invertebrate sequence entries, part 776.
1765. gbinv777.seq - Invertebrate sequence entries, part 777.
1766. gbinv778.seq - Invertebrate sequence entries, part 778.
1767. gbinv779.seq - Invertebrate sequence entries, part 779.
1768. gbinv78.seq - Invertebrate sequence entries, part 78.
1769. gbinv780.seq - Invertebrate sequence entries, part 780.
1770. gbinv781.seq - Invertebrate sequence entries, part 781.
1771. gbinv782.seq - Invertebrate sequence entries, part 782.
1772. gbinv783.seq - Invertebrate sequence entries, part 783.
1773. gbinv784.seq - Invertebrate sequence entries, part 784.
1774. gbinv785.seq - Invertebrate sequence entries, part 785.
1775. gbinv786.seq - Invertebrate sequence entries, part 786.
1776. gbinv787.seq - Invertebrate sequence entries, part 787.
1777. gbinv788.seq - Invertebrate sequence entries, part 788.
1778. gbinv789.seq - Invertebrate sequence entries, part 789.
1779. gbinv79.seq - Invertebrate sequence entries, part 79.
1780. gbinv790.seq - Invertebrate sequence entries, part 790.
1781. gbinv791.seq - Invertebrate sequence entries, part 791.
1782. gbinv792.seq - Invertebrate sequence entries, part 792.
1783. gbinv793.seq - Invertebrate sequence entries, part 793.
1784. gbinv794.seq - Invertebrate sequence entries, part 794.
1785. gbinv795.seq - Invertebrate sequence entries, part 795.
1786. gbinv796.seq - Invertebrate sequence entries, part 796.
1787. gbinv797.seq - Invertebrate sequence entries, part 797.
1788. gbinv798.seq - Invertebrate sequence entries, part 798.
1789. gbinv799.seq - Invertebrate sequence entries, part 799.
1790. gbinv8.seq - Invertebrate sequence entries, part 8.
1791. gbinv80.seq - Invertebrate sequence entries, part 80.
1792. gbinv800.seq - Invertebrate sequence entries, part 800.
1793. gbinv801.seq - Invertebrate sequence entries, part 801.
1794. gbinv802.seq - Invertebrate sequence entries, part 802.
1795. gbinv803.seq - Invertebrate sequence entries, part 803.
1796. gbinv804.seq - Invertebrate sequence entries, part 804.
1797. gbinv805.seq - Invertebrate sequence entries, part 805.
1798. gbinv806.seq - Invertebrate sequence entries, part 806.
1799. gbinv807.seq - Invertebrate sequence entries, part 807.
1800. gbinv808.seq - Invertebrate sequence entries, part 808.
1801. gbinv809.seq - Invertebrate sequence entries, part 809.
1802. gbinv81.seq - Invertebrate sequence entries, part 81.
1803. gbinv810.seq - Invertebrate sequence entries, part 810.
1804. gbinv811.seq - Invertebrate sequence entries, part 811.
1805. gbinv812.seq - Invertebrate sequence entries, part 812.
1806. gbinv813.seq - Invertebrate sequence entries, part 813.
1807. gbinv814.seq - Invertebrate sequence entries, part 814.
1808. gbinv815.seq - Invertebrate sequence entries, part 815.
1809. gbinv816.seq - Invertebrate sequence entries, part 816.
1810. gbinv817.seq - Invertebrate sequence entries, part 817.
1811. gbinv818.seq - Invertebrate sequence entries, part 818.
1812. gbinv819.seq - Invertebrate sequence entries, part 819.
1813. gbinv82.seq - Invertebrate sequence entries, part 82.
1814. gbinv820.seq - Invertebrate sequence entries, part 820.
1815. gbinv821.seq - Invertebrate sequence entries, part 821.
1816. gbinv822.seq - Invertebrate sequence entries, part 822.
1817. gbinv823.seq - Invertebrate sequence entries, part 823.
1818. gbinv824.seq - Invertebrate sequence entries, part 824.
1819. gbinv825.seq - Invertebrate sequence entries, part 825.
1820. gbinv826.seq - Invertebrate sequence entries, part 826.
1821. gbinv827.seq - Invertebrate sequence entries, part 827.
1822. gbinv828.seq - Invertebrate sequence entries, part 828.
1823. gbinv829.seq - Invertebrate sequence entries, part 829.
1824. gbinv83.seq - Invertebrate sequence entries, part 83.
1825. gbinv830.seq - Invertebrate sequence entries, part 830.
1826. gbinv831.seq - Invertebrate sequence entries, part 831.
1827. gbinv832.seq - Invertebrate sequence entries, part 832.
1828. gbinv833.seq - Invertebrate sequence entries, part 833.
1829. gbinv834.seq - Invertebrate sequence entries, part 834.
1830. gbinv835.seq - Invertebrate sequence entries, part 835.
1831. gbinv836.seq - Invertebrate sequence entries, part 836.
1832. gbinv837.seq - Invertebrate sequence entries, part 837.
1833. gbinv838.seq - Invertebrate sequence entries, part 838.
1834. gbinv839.seq - Invertebrate sequence entries, part 839.
1835. gbinv84.seq - Invertebrate sequence entries, part 84.
1836. gbinv840.seq - Invertebrate sequence entries, part 840.
1837. gbinv841.seq - Invertebrate sequence entries, part 841.
1838. gbinv842.seq - Invertebrate sequence entries, part 842.
1839. gbinv843.seq - Invertebrate sequence entries, part 843.
1840. gbinv844.seq - Invertebrate sequence entries, part 844.
1841. gbinv845.seq - Invertebrate sequence entries, part 845.
1842. gbinv846.seq - Invertebrate sequence entries, part 846.
1843. gbinv847.seq - Invertebrate sequence entries, part 847.
1844. gbinv848.seq - Invertebrate sequence entries, part 848.
1845. gbinv849.seq - Invertebrate sequence entries, part 849.
1846. gbinv85.seq - Invertebrate sequence entries, part 85.
1847. gbinv850.seq - Invertebrate sequence entries, part 850.
1848. gbinv851.seq - Invertebrate sequence entries, part 851.
1849. gbinv852.seq - Invertebrate sequence entries, part 852.
1850. gbinv853.seq - Invertebrate sequence entries, part 853.
1851. gbinv854.seq - Invertebrate sequence entries, part 854.
1852. gbinv855.seq - Invertebrate sequence entries, part 855.
1853. gbinv856.seq - Invertebrate sequence entries, part 856.
1854. gbinv857.seq - Invertebrate sequence entries, part 857.
1855. gbinv858.seq - Invertebrate sequence entries, part 858.
1856. gbinv859.seq - Invertebrate sequence entries, part 859.
1857. gbinv86.seq - Invertebrate sequence entries, part 86.
1858. gbinv860.seq - Invertebrate sequence entries, part 860.
1859. gbinv861.seq - Invertebrate sequence entries, part 861.
1860. gbinv862.seq - Invertebrate sequence entries, part 862.
1861. gbinv863.seq - Invertebrate sequence entries, part 863.
1862. gbinv864.seq - Invertebrate sequence entries, part 864.
1863. gbinv865.seq - Invertebrate sequence entries, part 865.
1864. gbinv866.seq - Invertebrate sequence entries, part 866.
1865. gbinv867.seq - Invertebrate sequence entries, part 867.
1866. gbinv868.seq - Invertebrate sequence entries, part 868.
1867. gbinv869.seq - Invertebrate sequence entries, part 869.
1868. gbinv87.seq - Invertebrate sequence entries, part 87.
1869. gbinv870.seq - Invertebrate sequence entries, part 870.
1870. gbinv871.seq - Invertebrate sequence entries, part 871.
1871. gbinv872.seq - Invertebrate sequence entries, part 872.
1872. gbinv873.seq - Invertebrate sequence entries, part 873.
1873. gbinv874.seq - Invertebrate sequence entries, part 874.
1874. gbinv875.seq - Invertebrate sequence entries, part 875.
1875. gbinv876.seq - Invertebrate sequence entries, part 876.
1876. gbinv877.seq - Invertebrate sequence entries, part 877.
1877. gbinv878.seq - Invertebrate sequence entries, part 878.
1878. gbinv879.seq - Invertebrate sequence entries, part 879.
1879. gbinv88.seq - Invertebrate sequence entries, part 88.
1880. gbinv880.seq - Invertebrate sequence entries, part 880.
1881. gbinv881.seq - Invertebrate sequence entries, part 881.
1882. gbinv882.seq - Invertebrate sequence entries, part 882.
1883. gbinv883.seq - Invertebrate sequence entries, part 883.
1884. gbinv884.seq - Invertebrate sequence entries, part 884.
1885. gbinv885.seq - Invertebrate sequence entries, part 885.
1886. gbinv886.seq - Invertebrate sequence entries, part 886.
1887. gbinv887.seq - Invertebrate sequence entries, part 887.
1888. gbinv888.seq - Invertebrate sequence entries, part 888.
1889. gbinv889.seq - Invertebrate sequence entries, part 889.
1890. gbinv89.seq - Invertebrate sequence entries, part 89.
1891. gbinv890.seq - Invertebrate sequence entries, part 890.
1892. gbinv891.seq - Invertebrate sequence entries, part 891.
1893. gbinv892.seq - Invertebrate sequence entries, part 892.
1894. gbinv893.seq - Invertebrate sequence entries, part 893.
1895. gbinv894.seq - Invertebrate sequence entries, part 894.
1896. gbinv895.seq - Invertebrate sequence entries, part 895.
1897. gbinv896.seq - Invertebrate sequence entries, part 896.
1898. gbinv897.seq - Invertebrate sequence entries, part 897.
1899. gbinv898.seq - Invertebrate sequence entries, part 898.
1900. gbinv899.seq - Invertebrate sequence entries, part 899.
1901. gbinv9.seq - Invertebrate sequence entries, part 9.
1902. gbinv90.seq - Invertebrate sequence entries, part 90.
1903. gbinv900.seq - Invertebrate sequence entries, part 900.
1904. gbinv901.seq - Invertebrate sequence entries, part 901.
1905. gbinv902.seq - Invertebrate sequence entries, part 902.
1906. gbinv903.seq - Invertebrate sequence entries, part 903.
1907. gbinv904.seq - Invertebrate sequence entries, part 904.
1908. gbinv905.seq - Invertebrate sequence entries, part 905.
1909. gbinv906.seq - Invertebrate sequence entries, part 906.
1910. gbinv907.seq - Invertebrate sequence entries, part 907.
1911. gbinv908.seq - Invertebrate sequence entries, part 908.
1912. gbinv909.seq - Invertebrate sequence entries, part 909.
1913. gbinv91.seq - Invertebrate sequence entries, part 91.
1914. gbinv910.seq - Invertebrate sequence entries, part 910.
1915. gbinv911.seq - Invertebrate sequence entries, part 911.
1916. gbinv912.seq - Invertebrate sequence entries, part 912.
1917. gbinv913.seq - Invertebrate sequence entries, part 913.
1918. gbinv914.seq - Invertebrate sequence entries, part 914.
1919. gbinv915.seq - Invertebrate sequence entries, part 915.
1920. gbinv916.seq - Invertebrate sequence entries, part 916.
1921. gbinv917.seq - Invertebrate sequence entries, part 917.
1922. gbinv918.seq - Invertebrate sequence entries, part 918.
1923. gbinv919.seq - Invertebrate sequence entries, part 919.
1924. gbinv92.seq - Invertebrate sequence entries, part 92.
1925. gbinv920.seq - Invertebrate sequence entries, part 920.
1926. gbinv921.seq - Invertebrate sequence entries, part 921.
1927. gbinv922.seq - Invertebrate sequence entries, part 922.
1928. gbinv923.seq - Invertebrate sequence entries, part 923.
1929. gbinv924.seq - Invertebrate sequence entries, part 924.
1930. gbinv925.seq - Invertebrate sequence entries, part 925.
1931. gbinv926.seq - Invertebrate sequence entries, part 926.
1932. gbinv927.seq - Invertebrate sequence entries, part 927.
1933. gbinv928.seq - Invertebrate sequence entries, part 928.
1934. gbinv929.seq - Invertebrate sequence entries, part 929.
1935. gbinv93.seq - Invertebrate sequence entries, part 93.
1936. gbinv930.seq - Invertebrate sequence entries, part 930.
1937. gbinv931.seq - Invertebrate sequence entries, part 931.
1938. gbinv932.seq - Invertebrate sequence entries, part 932.
1939. gbinv933.seq - Invertebrate sequence entries, part 933.
1940. gbinv934.seq - Invertebrate sequence entries, part 934.
1941. gbinv935.seq - Invertebrate sequence entries, part 935.
1942. gbinv936.seq - Invertebrate sequence entries, part 936.
1943. gbinv937.seq - Invertebrate sequence entries, part 937.
1944. gbinv938.seq - Invertebrate sequence entries, part 938.
1945. gbinv939.seq - Invertebrate sequence entries, part 939.
1946. gbinv94.seq - Invertebrate sequence entries, part 94.
1947. gbinv940.seq - Invertebrate sequence entries, part 940.
1948. gbinv941.seq - Invertebrate sequence entries, part 941.
1949. gbinv942.seq - Invertebrate sequence entries, part 942.
1950. gbinv943.seq - Invertebrate sequence entries, part 943.
1951. gbinv944.seq - Invertebrate sequence entries, part 944.
1952. gbinv945.seq - Invertebrate sequence entries, part 945.
1953. gbinv946.seq - Invertebrate sequence entries, part 946.
1954. gbinv947.seq - Invertebrate sequence entries, part 947.
1955. gbinv948.seq - Invertebrate sequence entries, part 948.
1956. gbinv949.seq - Invertebrate sequence entries, part 949.
1957. gbinv95.seq - Invertebrate sequence entries, part 95.
1958. gbinv950.seq - Invertebrate sequence entries, part 950.
1959. gbinv951.seq - Invertebrate sequence entries, part 951.
1960. gbinv952.seq - Invertebrate sequence entries, part 952.
1961. gbinv953.seq - Invertebrate sequence entries, part 953.
1962. gbinv954.seq - Invertebrate sequence entries, part 954.
1963. gbinv955.seq - Invertebrate sequence entries, part 955.
1964. gbinv956.seq - Invertebrate sequence entries, part 956.
1965. gbinv957.seq - Invertebrate sequence entries, part 957.
1966. gbinv958.seq - Invertebrate sequence entries, part 958.
1967. gbinv959.seq - Invertebrate sequence entries, part 959.
1968. gbinv96.seq - Invertebrate sequence entries, part 96.
1969. gbinv960.seq - Invertebrate sequence entries, part 960.
1970. gbinv961.seq - Invertebrate sequence entries, part 961.
1971. gbinv962.seq - Invertebrate sequence entries, part 962.
1972. gbinv963.seq - Invertebrate sequence entries, part 963.
1973. gbinv964.seq - Invertebrate sequence entries, part 964.
1974. gbinv965.seq - Invertebrate sequence entries, part 965.
1975. gbinv966.seq - Invertebrate sequence entries, part 966.
1976. gbinv967.seq - Invertebrate sequence entries, part 967.
1977. gbinv968.seq - Invertebrate sequence entries, part 968.
1978. gbinv969.seq - Invertebrate sequence entries, part 969.
1979. gbinv97.seq - Invertebrate sequence entries, part 97.
1980. gbinv970.seq - Invertebrate sequence entries, part 970.
1981. gbinv971.seq - Invertebrate sequence entries, part 971.
1982. gbinv972.seq - Invertebrate sequence entries, part 972.
1983. gbinv973.seq - Invertebrate sequence entries, part 973.
1984. gbinv974.seq - Invertebrate sequence entries, part 974.
1985. gbinv975.seq - Invertebrate sequence entries, part 975.
1986. gbinv976.seq - Invertebrate sequence entries, part 976.
1987. gbinv977.seq - Invertebrate sequence entries, part 977.
1988. gbinv978.seq - Invertebrate sequence entries, part 978.
1989. gbinv979.seq - Invertebrate sequence entries, part 979.
1990. gbinv98.seq - Invertebrate sequence entries, part 98.
1991. gbinv980.seq - Invertebrate sequence entries, part 980.
1992. gbinv981.seq - Invertebrate sequence entries, part 981.
1993. gbinv982.seq - Invertebrate sequence entries, part 982.
1994. gbinv983.seq - Invertebrate sequence entries, part 983.
1995. gbinv984.seq - Invertebrate sequence entries, part 984.
1996. gbinv985.seq - Invertebrate sequence entries, part 985.
1997. gbinv986.seq - Invertebrate sequence entries, part 986.
1998. gbinv987.seq - Invertebrate sequence entries, part 987.
1999. gbinv988.seq - Invertebrate sequence entries, part 988.
2000. gbinv989.seq - Invertebrate sequence entries, part 989.
2001. gbinv99.seq - Invertebrate sequence entries, part 99.
2002. gbinv990.seq - Invertebrate sequence entries, part 990.
2003. gbinv991.seq - Invertebrate sequence entries, part 991.
2004. gbinv992.seq - Invertebrate sequence entries, part 992.
2005. gbinv993.seq - Invertebrate sequence entries, part 993.
2006. gbinv994.seq - Invertebrate sequence entries, part 994.
2007. gbinv995.seq - Invertebrate sequence entries, part 995.
2008. gbinv996.seq - Invertebrate sequence entries, part 996.
2009. gbinv997.seq - Invertebrate sequence entries, part 997.
2010. gbinv998.seq - Invertebrate sequence entries, part 998.
2011. gbinv999.seq - Invertebrate sequence entries, part 999.
2012. gbmam1.seq - Other mammalian sequence entries, part 1.
2013. gbmam10.seq - Other mammalian sequence entries, part 10.
2014. gbmam100.seq - Other mammalian sequence entries, part 100.
2015. gbmam101.seq - Other mammalian sequence entries, part 101.
2016. gbmam102.seq - Other mammalian sequence entries, part 102.
2017. gbmam103.seq - Other mammalian sequence entries, part 103.
2018. gbmam104.seq - Other mammalian sequence entries, part 104.
2019. gbmam105.seq - Other mammalian sequence entries, part 105.
2020. gbmam106.seq - Other mammalian sequence entries, part 106.
2021. gbmam107.seq - Other mammalian sequence entries, part 107.
2022. gbmam108.seq - Other mammalian sequence entries, part 108.
2023. gbmam109.seq - Other mammalian sequence entries, part 109.
2024. gbmam11.seq - Other mammalian sequence entries, part 11.
2025. gbmam110.seq - Other mammalian sequence entries, part 110.
2026. gbmam111.seq - Other mammalian sequence entries, part 111.
2027. gbmam112.seq - Other mammalian sequence entries, part 112.
2028. gbmam113.seq - Other mammalian sequence entries, part 113.
2029. gbmam114.seq - Other mammalian sequence entries, part 114.
2030. gbmam115.seq - Other mammalian sequence entries, part 115.
2031. gbmam116.seq - Other mammalian sequence entries, part 116.
2032. gbmam117.seq - Other mammalian sequence entries, part 117.
2033. gbmam118.seq - Other mammalian sequence entries, part 118.
2034. gbmam119.seq - Other mammalian sequence entries, part 119.
2035. gbmam12.seq - Other mammalian sequence entries, part 12.
2036. gbmam120.seq - Other mammalian sequence entries, part 120.
2037. gbmam121.seq - Other mammalian sequence entries, part 121.
2038. gbmam122.seq - Other mammalian sequence entries, part 122.
2039. gbmam123.seq - Other mammalian sequence entries, part 123.
2040. gbmam124.seq - Other mammalian sequence entries, part 124.
2041. gbmam125.seq - Other mammalian sequence entries, part 125.
2042. gbmam126.seq - Other mammalian sequence entries, part 126.
2043. gbmam127.seq - Other mammalian sequence entries, part 127.
2044. gbmam128.seq - Other mammalian sequence entries, part 128.
2045. gbmam129.seq - Other mammalian sequence entries, part 129.
2046. gbmam13.seq - Other mammalian sequence entries, part 13.
2047. gbmam130.seq - Other mammalian sequence entries, part 130.
2048. gbmam131.seq - Other mammalian sequence entries, part 131.
2049. gbmam132.seq - Other mammalian sequence entries, part 132.
2050. gbmam133.seq - Other mammalian sequence entries, part 133.
2051. gbmam134.seq - Other mammalian sequence entries, part 134.
2052. gbmam135.seq - Other mammalian sequence entries, part 135.
2053. gbmam136.seq - Other mammalian sequence entries, part 136.
2054. gbmam137.seq - Other mammalian sequence entries, part 137.
2055. gbmam138.seq - Other mammalian sequence entries, part 138.
2056. gbmam139.seq - Other mammalian sequence entries, part 139.
2057. gbmam14.seq - Other mammalian sequence entries, part 14.
2058. gbmam140.seq - Other mammalian sequence entries, part 140.
2059. gbmam141.seq - Other mammalian sequence entries, part 141.
2060. gbmam142.seq - Other mammalian sequence entries, part 142.
2061. gbmam143.seq - Other mammalian sequence entries, part 143.
2062. gbmam144.seq - Other mammalian sequence entries, part 144.
2063. gbmam145.seq - Other mammalian sequence entries, part 145.
2064. gbmam146.seq - Other mammalian sequence entries, part 146.
2065. gbmam147.seq - Other mammalian sequence entries, part 147.
2066. gbmam148.seq - Other mammalian sequence entries, part 148.
2067. gbmam149.seq - Other mammalian sequence entries, part 149.
2068. gbmam15.seq - Other mammalian sequence entries, part 15.
2069. gbmam150.seq - Other mammalian sequence entries, part 150.
2070. gbmam151.seq - Other mammalian sequence entries, part 151.
2071. gbmam152.seq - Other mammalian sequence entries, part 152.
2072. gbmam153.seq - Other mammalian sequence entries, part 153.
2073. gbmam154.seq - Other mammalian sequence entries, part 154.
2074. gbmam155.seq - Other mammalian sequence entries, part 155.
2075. gbmam156.seq - Other mammalian sequence entries, part 156.
2076. gbmam157.seq - Other mammalian sequence entries, part 157.
2077. gbmam158.seq - Other mammalian sequence entries, part 158.
2078. gbmam159.seq - Other mammalian sequence entries, part 159.
2079. gbmam16.seq - Other mammalian sequence entries, part 16.
2080. gbmam160.seq - Other mammalian sequence entries, part 160.
2081. gbmam161.seq - Other mammalian sequence entries, part 161.
2082. gbmam162.seq - Other mammalian sequence entries, part 162.
2083. gbmam163.seq - Other mammalian sequence entries, part 163.
2084. gbmam164.seq - Other mammalian sequence entries, part 164.
2085. gbmam165.seq - Other mammalian sequence entries, part 165.
2086. gbmam166.seq - Other mammalian sequence entries, part 166.
2087. gbmam167.seq - Other mammalian sequence entries, part 167.
2088. gbmam168.seq - Other mammalian sequence entries, part 168.
2089. gbmam169.seq - Other mammalian sequence entries, part 169.
2090. gbmam17.seq - Other mammalian sequence entries, part 17.
2091. gbmam170.seq - Other mammalian sequence entries, part 170.
2092. gbmam171.seq - Other mammalian sequence entries, part 171.
2093. gbmam172.seq - Other mammalian sequence entries, part 172.
2094. gbmam173.seq - Other mammalian sequence entries, part 173.
2095. gbmam18.seq - Other mammalian sequence entries, part 18.
2096. gbmam19.seq - Other mammalian sequence entries, part 19.
2097. gbmam2.seq - Other mammalian sequence entries, part 2.
2098. gbmam20.seq - Other mammalian sequence entries, part 20.
2099. gbmam21.seq - Other mammalian sequence entries, part 21.
2100. gbmam22.seq - Other mammalian sequence entries, part 22.
2101. gbmam23.seq - Other mammalian sequence entries, part 23.
2102. gbmam24.seq - Other mammalian sequence entries, part 24.
2103. gbmam25.seq - Other mammalian sequence entries, part 25.
2104. gbmam26.seq - Other mammalian sequence entries, part 26.
2105. gbmam27.seq - Other mammalian sequence entries, part 27.
2106. gbmam28.seq - Other mammalian sequence entries, part 28.
2107. gbmam29.seq - Other mammalian sequence entries, part 29.
2108. gbmam3.seq - Other mammalian sequence entries, part 3.
2109. gbmam30.seq - Other mammalian sequence entries, part 30.
2110. gbmam31.seq - Other mammalian sequence entries, part 31.
2111. gbmam32.seq - Other mammalian sequence entries, part 32.
2112. gbmam33.seq - Other mammalian sequence entries, part 33.
2113. gbmam34.seq - Other mammalian sequence entries, part 34.
2114. gbmam35.seq - Other mammalian sequence entries, part 35.
2115. gbmam36.seq - Other mammalian sequence entries, part 36.
2116. gbmam37.seq - Other mammalian sequence entries, part 37.
2117. gbmam38.seq - Other mammalian sequence entries, part 38.
2118. gbmam39.seq - Other mammalian sequence entries, part 39.
2119. gbmam4.seq - Other mammalian sequence entries, part 4.
2120. gbmam40.seq - Other mammalian sequence entries, part 40.
2121. gbmam41.seq - Other mammalian sequence entries, part 41.
2122. gbmam42.seq - Other mammalian sequence entries, part 42.
2123. gbmam43.seq - Other mammalian sequence entries, part 43.
2124. gbmam44.seq - Other mammalian sequence entries, part 44.
2125. gbmam45.seq - Other mammalian sequence entries, part 45.
2126. gbmam46.seq - Other mammalian sequence entries, part 46.
2127. gbmam47.seq - Other mammalian sequence entries, part 47.
2128. gbmam48.seq - Other mammalian sequence entries, part 48.
2129. gbmam49.seq - Other mammalian sequence entries, part 49.
2130. gbmam5.seq - Other mammalian sequence entries, part 5.
2131. gbmam50.seq - Other mammalian sequence entries, part 50.
2132. gbmam51.seq - Other mammalian sequence entries, part 51.
2133. gbmam52.seq - Other mammalian sequence entries, part 52.
2134. gbmam53.seq - Other mammalian sequence entries, part 53.
2135. gbmam54.seq - Other mammalian sequence entries, part 54.
2136. gbmam55.seq - Other mammalian sequence entries, part 55.
2137. gbmam56.seq - Other mammalian sequence entries, part 56.
2138. gbmam57.seq - Other mammalian sequence entries, part 57.
2139. gbmam58.seq - Other mammalian sequence entries, part 58.
2140. gbmam59.seq - Other mammalian sequence entries, part 59.
2141. gbmam6.seq - Other mammalian sequence entries, part 6.
2142. gbmam60.seq - Other mammalian sequence entries, part 60.
2143. gbmam61.seq - Other mammalian sequence entries, part 61.
2144. gbmam62.seq - Other mammalian sequence entries, part 62.
2145. gbmam63.seq - Other mammalian sequence entries, part 63.
2146. gbmam64.seq - Other mammalian sequence entries, part 64.
2147. gbmam65.seq - Other mammalian sequence entries, part 65.
2148. gbmam66.seq - Other mammalian sequence entries, part 66.
2149. gbmam67.seq - Other mammalian sequence entries, part 67.
2150. gbmam68.seq - Other mammalian sequence entries, part 68.
2151. gbmam69.seq - Other mammalian sequence entries, part 69.
2152. gbmam7.seq - Other mammalian sequence entries, part 7.
2153. gbmam70.seq - Other mammalian sequence entries, part 70.
2154. gbmam71.seq - Other mammalian sequence entries, part 71.
2155. gbmam72.seq - Other mammalian sequence entries, part 72.
2156. gbmam73.seq - Other mammalian sequence entries, part 73.
2157. gbmam74.seq - Other mammalian sequence entries, part 74.
2158. gbmam75.seq - Other mammalian sequence entries, part 75.
2159. gbmam76.seq - Other mammalian sequence entries, part 76.
2160. gbmam77.seq - Other mammalian sequence entries, part 77.
2161. gbmam78.seq - Other mammalian sequence entries, part 78.
2162. gbmam79.seq - Other mammalian sequence entries, part 79.
2163. gbmam8.seq - Other mammalian sequence entries, part 8.
2164. gbmam80.seq - Other mammalian sequence entries, part 80.
2165. gbmam81.seq - Other mammalian sequence entries, part 81.
2166. gbmam82.seq - Other mammalian sequence entries, part 82.
2167. gbmam83.seq - Other mammalian sequence entries, part 83.
2168. gbmam84.seq - Other mammalian sequence entries, part 84.
2169. gbmam85.seq - Other mammalian sequence entries, part 85.
2170. gbmam86.seq - Other mammalian sequence entries, part 86.
2171. gbmam87.seq - Other mammalian sequence entries, part 87.
2172. gbmam88.seq - Other mammalian sequence entries, part 88.
2173. gbmam89.seq - Other mammalian sequence entries, part 89.
2174. gbmam9.seq - Other mammalian sequence entries, part 9.
2175. gbmam90.seq - Other mammalian sequence entries, part 90.
2176. gbmam91.seq - Other mammalian sequence entries, part 91.
2177. gbmam92.seq - Other mammalian sequence entries, part 92.
2178. gbmam93.seq - Other mammalian sequence entries, part 93.
2179. gbmam94.seq - Other mammalian sequence entries, part 94.
2180. gbmam95.seq - Other mammalian sequence entries, part 95.
2181. gbmam96.seq - Other mammalian sequence entries, part 96.
2182. gbmam97.seq - Other mammalian sequence entries, part 97.
2183. gbmam98.seq - Other mammalian sequence entries, part 98.
2184. gbmam99.seq - Other mammalian sequence entries, part 99.
2185. gbnew.txt - Accession numbers of entries new since the previous release.
2186. gbpat1.seq - Patent sequence entries, part 1.
2187. gbpat10.seq - Patent sequence entries, part 10.
2188. gbpat11.seq - Patent sequence entries, part 11.
2189. gbpat12.seq - Patent sequence entries, part 12.
2190. gbpat13.seq - Patent sequence entries, part 13.
2191. gbpat14.seq - Patent sequence entries, part 14.
2192. gbpat15.seq - Patent sequence entries, part 15.
2193. gbpat16.seq - Patent sequence entries, part 16.
2194. gbpat17.seq - Patent sequence entries, part 17.
2195. gbpat18.seq - Patent sequence entries, part 18.
2196. gbpat19.seq - Patent sequence entries, part 19.
2197. gbpat2.seq - Patent sequence entries, part 2.
2198. gbpat20.seq - Patent sequence entries, part 20.
2199. gbpat21.seq - Patent sequence entries, part 21.
2200. gbpat22.seq - Patent sequence entries, part 22.
2201. gbpat23.seq - Patent sequence entries, part 23.
2202. gbpat24.seq - Patent sequence entries, part 24.
2203. gbpat25.seq - Patent sequence entries, part 25.
2204. gbpat26.seq - Patent sequence entries, part 26.
2205. gbpat27.seq - Patent sequence entries, part 27.
2206. gbpat28.seq - Patent sequence entries, part 28.
2207. gbpat29.seq - Patent sequence entries, part 29.
2208. gbpat3.seq - Patent sequence entries, part 3.
2209. gbpat30.seq - Patent sequence entries, part 30.
2210. gbpat31.seq - Patent sequence entries, part 31.
2211. gbpat32.seq - Patent sequence entries, part 32.
2212. gbpat33.seq - Patent sequence entries, part 33.
2213. gbpat34.seq - Patent sequence entries, part 34.
2214. gbpat35.seq - Patent sequence entries, part 35.
2215. gbpat36.seq - Patent sequence entries, part 36.
2216. gbpat37.seq - Patent sequence entries, part 37.
2217. gbpat38.seq - Patent sequence entries, part 38.
2218. gbpat39.seq - Patent sequence entries, part 39.
2219. gbpat4.seq - Patent sequence entries, part 4.
2220. gbpat40.seq - Patent sequence entries, part 40.
2221. gbpat41.seq - Patent sequence entries, part 41.
2222. gbpat42.seq - Patent sequence entries, part 42.
2223. gbpat43.seq - Patent sequence entries, part 43.
2224. gbpat44.seq - Patent sequence entries, part 44.
2225. gbpat45.seq - Patent sequence entries, part 45.
2226. gbpat46.seq - Patent sequence entries, part 46.
2227. gbpat47.seq - Patent sequence entries, part 47.
2228. gbpat48.seq - Patent sequence entries, part 48.
2229. gbpat49.seq - Patent sequence entries, part 49.
2230. gbpat5.seq - Patent sequence entries, part 5.
2231. gbpat50.seq - Patent sequence entries, part 50.
2232. gbpat51.seq - Patent sequence entries, part 51.
2233. gbpat52.seq - Patent sequence entries, part 52.
2234. gbpat53.seq - Patent sequence entries, part 53.
2235. gbpat54.seq - Patent sequence entries, part 54.
2236. gbpat55.seq - Patent sequence entries, part 55.
2237. gbpat56.seq - Patent sequence entries, part 56.
2238. gbpat57.seq - Patent sequence entries, part 57.
2239. gbpat58.seq - Patent sequence entries, part 58.
2240. gbpat59.seq - Patent sequence entries, part 59.
2241. gbpat6.seq - Patent sequence entries, part 6.
2242. gbpat60.seq - Patent sequence entries, part 60.
2243. gbpat61.seq - Patent sequence entries, part 61.
2244. gbpat62.seq - Patent sequence entries, part 62.
2245. gbpat63.seq - Patent sequence entries, part 63.
2246. gbpat64.seq - Patent sequence entries, part 64.
2247. gbpat65.seq - Patent sequence entries, part 65.
2248. gbpat66.seq - Patent sequence entries, part 66.
2249. gbpat67.seq - Patent sequence entries, part 67.
2250. gbpat68.seq - Patent sequence entries, part 68.
2251. gbpat69.seq - Patent sequence entries, part 69.
2252. gbpat7.seq - Patent sequence entries, part 7.
2253. gbpat70.seq - Patent sequence entries, part 70.
2254. gbpat71.seq - Patent sequence entries, part 71.
2255. gbpat72.seq - Patent sequence entries, part 72.
2256. gbpat73.seq - Patent sequence entries, part 73.
2257. gbpat74.seq - Patent sequence entries, part 74.
2258. gbpat75.seq - Patent sequence entries, part 75.
2259. gbpat76.seq - Patent sequence entries, part 76.
2260. gbpat77.seq - Patent sequence entries, part 77.
2261. gbpat78.seq - Patent sequence entries, part 78.
2262. gbpat79.seq - Patent sequence entries, part 79.
2263. gbpat8.seq - Patent sequence entries, part 8.
2264. gbpat80.seq - Patent sequence entries, part 80.
2265. gbpat81.seq - Patent sequence entries, part 81.
2266. gbpat9.seq - Patent sequence entries, part 9.
2267. gbphg1.seq - Phage sequence entries, part 1.
2268. gbphg2.seq - Phage sequence entries, part 2.
2269. gbphg3.seq - Phage sequence entries, part 3.
2270. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2271. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2272. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2273. gbpln1000.seq - Plant sequence entries (including fungi and algae), part 1000.
2274. gbpln1001.seq - Plant sequence entries (including fungi and algae), part 1001.
2275. gbpln1002.seq - Plant sequence entries (including fungi and algae), part 1002.
2276. gbpln1003.seq - Plant sequence entries (including fungi and algae), part 1003.
2277. gbpln1004.seq - Plant sequence entries (including fungi and algae), part 1004.
2278. gbpln1005.seq - Plant sequence entries (including fungi and algae), part 1005.
2279. gbpln1006.seq - Plant sequence entries (including fungi and algae), part 1006.
2280. gbpln1007.seq - Plant sequence entries (including fungi and algae), part 1007.
2281. gbpln1008.seq - Plant sequence entries (including fungi and algae), part 1008.
2282. gbpln1009.seq - Plant sequence entries (including fungi and algae), part 1009.
2283. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2284. gbpln1010.seq - Plant sequence entries (including fungi and algae), part 1010.
2285. gbpln1011.seq - Plant sequence entries (including fungi and algae), part 1011.
2286. gbpln1012.seq - Plant sequence entries (including fungi and algae), part 1012.
2287. gbpln1013.seq - Plant sequence entries (including fungi and algae), part 1013.
2288. gbpln1014.seq - Plant sequence entries (including fungi and algae), part 1014.
2289. gbpln1015.seq - Plant sequence entries (including fungi and algae), part 1015.
2290. gbpln1016.seq - Plant sequence entries (including fungi and algae), part 1016.
2291. gbpln1017.seq - Plant sequence entries (including fungi and algae), part 1017.
2292. gbpln1018.seq - Plant sequence entries (including fungi and algae), part 1018.
2293. gbpln1019.seq - Plant sequence entries (including fungi and algae), part 1019.
2294. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2295. gbpln1020.seq - Plant sequence entries (including fungi and algae), part 1020.
2296. gbpln1021.seq - Plant sequence entries (including fungi and algae), part 1021.
2297. gbpln1022.seq - Plant sequence entries (including fungi and algae), part 1022.
2298. gbpln1023.seq - Plant sequence entries (including fungi and algae), part 1023.
2299. gbpln1024.seq - Plant sequence entries (including fungi and algae), part 1024.
2300. gbpln1025.seq - Plant sequence entries (including fungi and algae), part 1025.
2301. gbpln1026.seq - Plant sequence entries (including fungi and algae), part 1026.
2302. gbpln1027.seq - Plant sequence entries (including fungi and algae), part 1027.
2303. gbpln1028.seq - Plant sequence entries (including fungi and algae), part 1028.
2304. gbpln1029.seq - Plant sequence entries (including fungi and algae), part 1029.
2305. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2306. gbpln1030.seq - Plant sequence entries (including fungi and algae), part 1030.
2307. gbpln1031.seq - Plant sequence entries (including fungi and algae), part 1031.
2308. gbpln1032.seq - Plant sequence entries (including fungi and algae), part 1032.
2309. gbpln1033.seq - Plant sequence entries (including fungi and algae), part 1033.
2310. gbpln1034.seq - Plant sequence entries (including fungi and algae), part 1034.
2311. gbpln1035.seq - Plant sequence entries (including fungi and algae), part 1035.
2312. gbpln1036.seq - Plant sequence entries (including fungi and algae), part 1036.
2313. gbpln1037.seq - Plant sequence entries (including fungi and algae), part 1037.
2314. gbpln1038.seq - Plant sequence entries (including fungi and algae), part 1038.
2315. gbpln1039.seq - Plant sequence entries (including fungi and algae), part 1039.
2316. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2317. gbpln1040.seq - Plant sequence entries (including fungi and algae), part 1040.
2318. gbpln1041.seq - Plant sequence entries (including fungi and algae), part 1041.
2319. gbpln1042.seq - Plant sequence entries (including fungi and algae), part 1042.
2320. gbpln1043.seq - Plant sequence entries (including fungi and algae), part 1043.
2321. gbpln1044.seq - Plant sequence entries (including fungi and algae), part 1044.
2322. gbpln1045.seq - Plant sequence entries (including fungi and algae), part 1045.
2323. gbpln1046.seq - Plant sequence entries (including fungi and algae), part 1046.
2324. gbpln1047.seq - Plant sequence entries (including fungi and algae), part 1047.
2325. gbpln1048.seq - Plant sequence entries (including fungi and algae), part 1048.
2326. gbpln1049.seq - Plant sequence entries (including fungi and algae), part 1049.
2327. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2328. gbpln1050.seq - Plant sequence entries (including fungi and algae), part 1050.
2329. gbpln1051.seq - Plant sequence entries (including fungi and algae), part 1051.
2330. gbpln1052.seq - Plant sequence entries (including fungi and algae), part 1052.
2331. gbpln1053.seq - Plant sequence entries (including fungi and algae), part 1053.
2332. gbpln1054.seq - Plant sequence entries (including fungi and algae), part 1054.
2333. gbpln1055.seq - Plant sequence entries (including fungi and algae), part 1055.
2334. gbpln1056.seq - Plant sequence entries (including fungi and algae), part 1056.
2335. gbpln1057.seq - Plant sequence entries (including fungi and algae), part 1057.
2336. gbpln1058.seq - Plant sequence entries (including fungi and algae), part 1058.
2337. gbpln1059.seq - Plant sequence entries (including fungi and algae), part 1059.
2338. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2339. gbpln1060.seq - Plant sequence entries (including fungi and algae), part 1060.
2340. gbpln1061.seq - Plant sequence entries (including fungi and algae), part 1061.
2341. gbpln1062.seq - Plant sequence entries (including fungi and algae), part 1062.
2342. gbpln1063.seq - Plant sequence entries (including fungi and algae), part 1063.
2343. gbpln1064.seq - Plant sequence entries (including fungi and algae), part 1064.
2344. gbpln1065.seq - Plant sequence entries (including fungi and algae), part 1065.
2345. gbpln1066.seq - Plant sequence entries (including fungi and algae), part 1066.
2346. gbpln1067.seq - Plant sequence entries (including fungi and algae), part 1067.
2347. gbpln1068.seq - Plant sequence entries (including fungi and algae), part 1068.
2348. gbpln1069.seq - Plant sequence entries (including fungi and algae), part 1069.
2349. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2350. gbpln1070.seq - Plant sequence entries (including fungi and algae), part 1070.
2351. gbpln1071.seq - Plant sequence entries (including fungi and algae), part 1071.
2352. gbpln1072.seq - Plant sequence entries (including fungi and algae), part 1072.
2353. gbpln1073.seq - Plant sequence entries (including fungi and algae), part 1073.
2354. gbpln1074.seq - Plant sequence entries (including fungi and algae), part 1074.
2355. gbpln1075.seq - Plant sequence entries (including fungi and algae), part 1075.
2356. gbpln1076.seq - Plant sequence entries (including fungi and algae), part 1076.
2357. gbpln1077.seq - Plant sequence entries (including fungi and algae), part 1077.
2358. gbpln1078.seq - Plant sequence entries (including fungi and algae), part 1078.
2359. gbpln1079.seq - Plant sequence entries (including fungi and algae), part 1079.
2360. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2361. gbpln1080.seq - Plant sequence entries (including fungi and algae), part 1080.
2362. gbpln1081.seq - Plant sequence entries (including fungi and algae), part 1081.
2363. gbpln1082.seq - Plant sequence entries (including fungi and algae), part 1082.
2364. gbpln1083.seq - Plant sequence entries (including fungi and algae), part 1083.
2365. gbpln1084.seq - Plant sequence entries (including fungi and algae), part 1084.
2366. gbpln1085.seq - Plant sequence entries (including fungi and algae), part 1085.
2367. gbpln1086.seq - Plant sequence entries (including fungi and algae), part 1086.
2368. gbpln1087.seq - Plant sequence entries (including fungi and algae), part 1087.
2369. gbpln1088.seq - Plant sequence entries (including fungi and algae), part 1088.
2370. gbpln1089.seq - Plant sequence entries (including fungi and algae), part 1089.
2371. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2372. gbpln1090.seq - Plant sequence entries (including fungi and algae), part 1090.
2373. gbpln1091.seq - Plant sequence entries (including fungi and algae), part 1091.
2374. gbpln1092.seq - Plant sequence entries (including fungi and algae), part 1092.
2375. gbpln1093.seq - Plant sequence entries (including fungi and algae), part 1093.
2376. gbpln1094.seq - Plant sequence entries (including fungi and algae), part 1094.
2377. gbpln1095.seq - Plant sequence entries (including fungi and algae), part 1095.
2378. gbpln1096.seq - Plant sequence entries (including fungi and algae), part 1096.
2379. gbpln1097.seq - Plant sequence entries (including fungi and algae), part 1097.
2380. gbpln1098.seq - Plant sequence entries (including fungi and algae), part 1098.
2381. gbpln1099.seq - Plant sequence entries (including fungi and algae), part 1099.
2382. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2383. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2384. gbpln1100.seq - Plant sequence entries (including fungi and algae), part 1100.
2385. gbpln1101.seq - Plant sequence entries (including fungi and algae), part 1101.
2386. gbpln1102.seq - Plant sequence entries (including fungi and algae), part 1102.
2387. gbpln1103.seq - Plant sequence entries (including fungi and algae), part 1103.
2388. gbpln1104.seq - Plant sequence entries (including fungi and algae), part 1104.
2389. gbpln1105.seq - Plant sequence entries (including fungi and algae), part 1105.
2390. gbpln1106.seq - Plant sequence entries (including fungi and algae), part 1106.
2391. gbpln1107.seq - Plant sequence entries (including fungi and algae), part 1107.
2392. gbpln1108.seq - Plant sequence entries (including fungi and algae), part 1108.
2393. gbpln1109.seq - Plant sequence entries (including fungi and algae), part 1109.
2394. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2395. gbpln1110.seq - Plant sequence entries (including fungi and algae), part 1110.
2396. gbpln1111.seq - Plant sequence entries (including fungi and algae), part 1111.
2397. gbpln1112.seq - Plant sequence entries (including fungi and algae), part 1112.
2398. gbpln1113.seq - Plant sequence entries (including fungi and algae), part 1113.
2399. gbpln1114.seq - Plant sequence entries (including fungi and algae), part 1114.
2400. gbpln1115.seq - Plant sequence entries (including fungi and algae), part 1115.
2401. gbpln1116.seq - Plant sequence entries (including fungi and algae), part 1116.
2402. gbpln1117.seq - Plant sequence entries (including fungi and algae), part 1117.
2403. gbpln1118.seq - Plant sequence entries (including fungi and algae), part 1118.
2404. gbpln1119.seq - Plant sequence entries (including fungi and algae), part 1119.
2405. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2406. gbpln1120.seq - Plant sequence entries (including fungi and algae), part 1120.
2407. gbpln1121.seq - Plant sequence entries (including fungi and algae), part 1121.
2408. gbpln1122.seq - Plant sequence entries (including fungi and algae), part 1122.
2409. gbpln1123.seq - Plant sequence entries (including fungi and algae), part 1123.
2410. gbpln1124.seq - Plant sequence entries (including fungi and algae), part 1124.
2411. gbpln1125.seq - Plant sequence entries (including fungi and algae), part 1125.
2412. gbpln1126.seq - Plant sequence entries (including fungi and algae), part 1126.
2413. gbpln1127.seq - Plant sequence entries (including fungi and algae), part 1127.
2414. gbpln1128.seq - Plant sequence entries (including fungi and algae), part 1128.
2415. gbpln1129.seq - Plant sequence entries (including fungi and algae), part 1129.
2416. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2417. gbpln1130.seq - Plant sequence entries (including fungi and algae), part 1130.
2418. gbpln1131.seq - Plant sequence entries (including fungi and algae), part 1131.
2419. gbpln1132.seq - Plant sequence entries (including fungi and algae), part 1132.
2420. gbpln1133.seq - Plant sequence entries (including fungi and algae), part 1133.
2421. gbpln1134.seq - Plant sequence entries (including fungi and algae), part 1134.
2422. gbpln1135.seq - Plant sequence entries (including fungi and algae), part 1135.
2423. gbpln1136.seq - Plant sequence entries (including fungi and algae), part 1136.
2424. gbpln1137.seq - Plant sequence entries (including fungi and algae), part 1137.
2425. gbpln1138.seq - Plant sequence entries (including fungi and algae), part 1138.
2426. gbpln1139.seq - Plant sequence entries (including fungi and algae), part 1139.
2427. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2428. gbpln1140.seq - Plant sequence entries (including fungi and algae), part 1140.
2429. gbpln1141.seq - Plant sequence entries (including fungi and algae), part 1141.
2430. gbpln1142.seq - Plant sequence entries (including fungi and algae), part 1142.
2431. gbpln1143.seq - Plant sequence entries (including fungi and algae), part 1143.
2432. gbpln1144.seq - Plant sequence entries (including fungi and algae), part 1144.
2433. gbpln1145.seq - Plant sequence entries (including fungi and algae), part 1145.
2434. gbpln1146.seq - Plant sequence entries (including fungi and algae), part 1146.
2435. gbpln1147.seq - Plant sequence entries (including fungi and algae), part 1147.
2436. gbpln1148.seq - Plant sequence entries (including fungi and algae), part 1148.
2437. gbpln1149.seq - Plant sequence entries (including fungi and algae), part 1149.
2438. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2439. gbpln1150.seq - Plant sequence entries (including fungi and algae), part 1150.
2440. gbpln1151.seq - Plant sequence entries (including fungi and algae), part 1151.
2441. gbpln1152.seq - Plant sequence entries (including fungi and algae), part 1152.
2442. gbpln1153.seq - Plant sequence entries (including fungi and algae), part 1153.
2443. gbpln1154.seq - Plant sequence entries (including fungi and algae), part 1154.
2444. gbpln1155.seq - Plant sequence entries (including fungi and algae), part 1155.
2445. gbpln1156.seq - Plant sequence entries (including fungi and algae), part 1156.
2446. gbpln1157.seq - Plant sequence entries (including fungi and algae), part 1157.
2447. gbpln1158.seq - Plant sequence entries (including fungi and algae), part 1158.
2448. gbpln1159.seq - Plant sequence entries (including fungi and algae), part 1159.
2449. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2450. gbpln1160.seq - Plant sequence entries (including fungi and algae), part 1160.
2451. gbpln1161.seq - Plant sequence entries (including fungi and algae), part 1161.
2452. gbpln1162.seq - Plant sequence entries (including fungi and algae), part 1162.
2453. gbpln1163.seq - Plant sequence entries (including fungi and algae), part 1163.
2454. gbpln1164.seq - Plant sequence entries (including fungi and algae), part 1164.
2455. gbpln1165.seq - Plant sequence entries (including fungi and algae), part 1165.
2456. gbpln1166.seq - Plant sequence entries (including fungi and algae), part 1166.
2457. gbpln1167.seq - Plant sequence entries (including fungi and algae), part 1167.
2458. gbpln1168.seq - Plant sequence entries (including fungi and algae), part 1168.
2459. gbpln1169.seq - Plant sequence entries (including fungi and algae), part 1169.
2460. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2461. gbpln1170.seq - Plant sequence entries (including fungi and algae), part 1170.
2462. gbpln1171.seq - Plant sequence entries (including fungi and algae), part 1171.
2463. gbpln1172.seq - Plant sequence entries (including fungi and algae), part 1172.
2464. gbpln1173.seq - Plant sequence entries (including fungi and algae), part 1173.
2465. gbpln1174.seq - Plant sequence entries (including fungi and algae), part 1174.
2466. gbpln1175.seq - Plant sequence entries (including fungi and algae), part 1175.
2467. gbpln1176.seq - Plant sequence entries (including fungi and algae), part 1176.
2468. gbpln1177.seq - Plant sequence entries (including fungi and algae), part 1177.
2469. gbpln1178.seq - Plant sequence entries (including fungi and algae), part 1178.
2470. gbpln1179.seq - Plant sequence entries (including fungi and algae), part 1179.
2471. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2472. gbpln1180.seq - Plant sequence entries (including fungi and algae), part 1180.
2473. gbpln1181.seq - Plant sequence entries (including fungi and algae), part 1181.
2474. gbpln1182.seq - Plant sequence entries (including fungi and algae), part 1182.
2475. gbpln1183.seq - Plant sequence entries (including fungi and algae), part 1183.
2476. gbpln1184.seq - Plant sequence entries (including fungi and algae), part 1184.
2477. gbpln1185.seq - Plant sequence entries (including fungi and algae), part 1185.
2478. gbpln1186.seq - Plant sequence entries (including fungi and algae), part 1186.
2479. gbpln1187.seq - Plant sequence entries (including fungi and algae), part 1187.
2480. gbpln1188.seq - Plant sequence entries (including fungi and algae), part 1188.
2481. gbpln1189.seq - Plant sequence entries (including fungi and algae), part 1189.
2482. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2483. gbpln1190.seq - Plant sequence entries (including fungi and algae), part 1190.
2484. gbpln1191.seq - Plant sequence entries (including fungi and algae), part 1191.
2485. gbpln1192.seq - Plant sequence entries (including fungi and algae), part 1192.
2486. gbpln1193.seq - Plant sequence entries (including fungi and algae), part 1193.
2487. gbpln1194.seq - Plant sequence entries (including fungi and algae), part 1194.
2488. gbpln1195.seq - Plant sequence entries (including fungi and algae), part 1195.
2489. gbpln1196.seq - Plant sequence entries (including fungi and algae), part 1196.
2490. gbpln1197.seq - Plant sequence entries (including fungi and algae), part 1197.
2491. gbpln1198.seq - Plant sequence entries (including fungi and algae), part 1198.
2492. gbpln1199.seq - Plant sequence entries (including fungi and algae), part 1199.
2493. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2494. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2495. gbpln1200.seq - Plant sequence entries (including fungi and algae), part 1200.
2496. gbpln1201.seq - Plant sequence entries (including fungi and algae), part 1201.
2497. gbpln1202.seq - Plant sequence entries (including fungi and algae), part 1202.
2498. gbpln1203.seq - Plant sequence entries (including fungi and algae), part 1203.
2499. gbpln1204.seq - Plant sequence entries (including fungi and algae), part 1204.
2500. gbpln1205.seq - Plant sequence entries (including fungi and algae), part 1205.
2501. gbpln1206.seq - Plant sequence entries (including fungi and algae), part 1206.
2502. gbpln1207.seq - Plant sequence entries (including fungi and algae), part 1207.
2503. gbpln1208.seq - Plant sequence entries (including fungi and algae), part 1208.
2504. gbpln1209.seq - Plant sequence entries (including fungi and algae), part 1209.
2505. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2506. gbpln1210.seq - Plant sequence entries (including fungi and algae), part 1210.
2507. gbpln1211.seq - Plant sequence entries (including fungi and algae), part 1211.
2508. gbpln1212.seq - Plant sequence entries (including fungi and algae), part 1212.
2509. gbpln1213.seq - Plant sequence entries (including fungi and algae), part 1213.
2510. gbpln1214.seq - Plant sequence entries (including fungi and algae), part 1214.
2511. gbpln1215.seq - Plant sequence entries (including fungi and algae), part 1215.
2512. gbpln1216.seq - Plant sequence entries (including fungi and algae), part 1216.
2513. gbpln1217.seq - Plant sequence entries (including fungi and algae), part 1217.
2514. gbpln1218.seq - Plant sequence entries (including fungi and algae), part 1218.
2515. gbpln1219.seq - Plant sequence entries (including fungi and algae), part 1219.
2516. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2517. gbpln1220.seq - Plant sequence entries (including fungi and algae), part 1220.
2518. gbpln1221.seq - Plant sequence entries (including fungi and algae), part 1221.
2519. gbpln1222.seq - Plant sequence entries (including fungi and algae), part 1222.
2520. gbpln1223.seq - Plant sequence entries (including fungi and algae), part 1223.
2521. gbpln1224.seq - Plant sequence entries (including fungi and algae), part 1224.
2522. gbpln1225.seq - Plant sequence entries (including fungi and algae), part 1225.
2523. gbpln1226.seq - Plant sequence entries (including fungi and algae), part 1226.
2524. gbpln1227.seq - Plant sequence entries (including fungi and algae), part 1227.
2525. gbpln1228.seq - Plant sequence entries (including fungi and algae), part 1228.
2526. gbpln1229.seq - Plant sequence entries (including fungi and algae), part 1229.
2527. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2528. gbpln1230.seq - Plant sequence entries (including fungi and algae), part 1230.
2529. gbpln1231.seq - Plant sequence entries (including fungi and algae), part 1231.
2530. gbpln1232.seq - Plant sequence entries (including fungi and algae), part 1232.
2531. gbpln1233.seq - Plant sequence entries (including fungi and algae), part 1233.
2532. gbpln1234.seq - Plant sequence entries (including fungi and algae), part 1234.
2533. gbpln1235.seq - Plant sequence entries (including fungi and algae), part 1235.
2534. gbpln1236.seq - Plant sequence entries (including fungi and algae), part 1236.
2535. gbpln1237.seq - Plant sequence entries (including fungi and algae), part 1237.
2536. gbpln1238.seq - Plant sequence entries (including fungi and algae), part 1238.
2537. gbpln1239.seq - Plant sequence entries (including fungi and algae), part 1239.
2538. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2539. gbpln1240.seq - Plant sequence entries (including fungi and algae), part 1240.
2540. gbpln1241.seq - Plant sequence entries (including fungi and algae), part 1241.
2541. gbpln1242.seq - Plant sequence entries (including fungi and algae), part 1242.
2542. gbpln1243.seq - Plant sequence entries (including fungi and algae), part 1243.
2543. gbpln1244.seq - Plant sequence entries (including fungi and algae), part 1244.
2544. gbpln1245.seq - Plant sequence entries (including fungi and algae), part 1245.
2545. gbpln1246.seq - Plant sequence entries (including fungi and algae), part 1246.
2546. gbpln1247.seq - Plant sequence entries (including fungi and algae), part 1247.
2547. gbpln1248.seq - Plant sequence entries (including fungi and algae), part 1248.
2548. gbpln1249.seq - Plant sequence entries (including fungi and algae), part 1249.
2549. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2550. gbpln1250.seq - Plant sequence entries (including fungi and algae), part 1250.
2551. gbpln1251.seq - Plant sequence entries (including fungi and algae), part 1251.
2552. gbpln1252.seq - Plant sequence entries (including fungi and algae), part 1252.
2553. gbpln1253.seq - Plant sequence entries (including fungi and algae), part 1253.
2554. gbpln1254.seq - Plant sequence entries (including fungi and algae), part 1254.
2555. gbpln1255.seq - Plant sequence entries (including fungi and algae), part 1255.
2556. gbpln1256.seq - Plant sequence entries (including fungi and algae), part 1256.
2557. gbpln1257.seq - Plant sequence entries (including fungi and algae), part 1257.
2558. gbpln1258.seq - Plant sequence entries (including fungi and algae), part 1258.
2559. gbpln1259.seq - Plant sequence entries (including fungi and algae), part 1259.
2560. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2561. gbpln1260.seq - Plant sequence entries (including fungi and algae), part 1260.
2562. gbpln1261.seq - Plant sequence entries (including fungi and algae), part 1261.
2563. gbpln1262.seq - Plant sequence entries (including fungi and algae), part 1262.
2564. gbpln1263.seq - Plant sequence entries (including fungi and algae), part 1263.
2565. gbpln1264.seq - Plant sequence entries (including fungi and algae), part 1264.
2566. gbpln1265.seq - Plant sequence entries (including fungi and algae), part 1265.
2567. gbpln1266.seq - Plant sequence entries (including fungi and algae), part 1266.
2568. gbpln1267.seq - Plant sequence entries (including fungi and algae), part 1267.
2569. gbpln1268.seq - Plant sequence entries (including fungi and algae), part 1268.
2570. gbpln1269.seq - Plant sequence entries (including fungi and algae), part 1269.
2571. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2572. gbpln1270.seq - Plant sequence entries (including fungi and algae), part 1270.
2573. gbpln1271.seq - Plant sequence entries (including fungi and algae), part 1271.
2574. gbpln1272.seq - Plant sequence entries (including fungi and algae), part 1272.
2575. gbpln1273.seq - Plant sequence entries (including fungi and algae), part 1273.
2576. gbpln1274.seq - Plant sequence entries (including fungi and algae), part 1274.
2577. gbpln1275.seq - Plant sequence entries (including fungi and algae), part 1275.
2578. gbpln1276.seq - Plant sequence entries (including fungi and algae), part 1276.
2579. gbpln1277.seq - Plant sequence entries (including fungi and algae), part 1277.
2580. gbpln1278.seq - Plant sequence entries (including fungi and algae), part 1278.
2581. gbpln1279.seq - Plant sequence entries (including fungi and algae), part 1279.
2582. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2583. gbpln1280.seq - Plant sequence entries (including fungi and algae), part 1280.
2584. gbpln1281.seq - Plant sequence entries (including fungi and algae), part 1281.
2585. gbpln1282.seq - Plant sequence entries (including fungi and algae), part 1282.
2586. gbpln1283.seq - Plant sequence entries (including fungi and algae), part 1283.
2587. gbpln1284.seq - Plant sequence entries (including fungi and algae), part 1284.
2588. gbpln1285.seq - Plant sequence entries (including fungi and algae), part 1285.
2589. gbpln1286.seq - Plant sequence entries (including fungi and algae), part 1286.
2590. gbpln1287.seq - Plant sequence entries (including fungi and algae), part 1287.
2591. gbpln1288.seq - Plant sequence entries (including fungi and algae), part 1288.
2592. gbpln1289.seq - Plant sequence entries (including fungi and algae), part 1289.
2593. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2594. gbpln1290.seq - Plant sequence entries (including fungi and algae), part 1290.
2595. gbpln1291.seq - Plant sequence entries (including fungi and algae), part 1291.
2596. gbpln1292.seq - Plant sequence entries (including fungi and algae), part 1292.
2597. gbpln1293.seq - Plant sequence entries (including fungi and algae), part 1293.
2598. gbpln1294.seq - Plant sequence entries (including fungi and algae), part 1294.
2599. gbpln1295.seq - Plant sequence entries (including fungi and algae), part 1295.
2600. gbpln1296.seq - Plant sequence entries (including fungi and algae), part 1296.
2601. gbpln1297.seq - Plant sequence entries (including fungi and algae), part 1297.
2602. gbpln1298.seq - Plant sequence entries (including fungi and algae), part 1298.
2603. gbpln1299.seq - Plant sequence entries (including fungi and algae), part 1299.
2604. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2605. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2606. gbpln1300.seq - Plant sequence entries (including fungi and algae), part 1300.
2607. gbpln1301.seq - Plant sequence entries (including fungi and algae), part 1301.
2608. gbpln1302.seq - Plant sequence entries (including fungi and algae), part 1302.
2609. gbpln1303.seq - Plant sequence entries (including fungi and algae), part 1303.
2610. gbpln1304.seq - Plant sequence entries (including fungi and algae), part 1304.
2611. gbpln1305.seq - Plant sequence entries (including fungi and algae), part 1305.
2612. gbpln1306.seq - Plant sequence entries (including fungi and algae), part 1306.
2613. gbpln1307.seq - Plant sequence entries (including fungi and algae), part 1307.
2614. gbpln1308.seq - Plant sequence entries (including fungi and algae), part 1308.
2615. gbpln1309.seq - Plant sequence entries (including fungi and algae), part 1309.
2616. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2617. gbpln1310.seq - Plant sequence entries (including fungi and algae), part 1310.
2618. gbpln1311.seq - Plant sequence entries (including fungi and algae), part 1311.
2619. gbpln1312.seq - Plant sequence entries (including fungi and algae), part 1312.
2620. gbpln1313.seq - Plant sequence entries (including fungi and algae), part 1313.
2621. gbpln1314.seq - Plant sequence entries (including fungi and algae), part 1314.
2622. gbpln1315.seq - Plant sequence entries (including fungi and algae), part 1315.
2623. gbpln1316.seq - Plant sequence entries (including fungi and algae), part 1316.
2624. gbpln1317.seq - Plant sequence entries (including fungi and algae), part 1317.
2625. gbpln1318.seq - Plant sequence entries (including fungi and algae), part 1318.
2626. gbpln1319.seq - Plant sequence entries (including fungi and algae), part 1319.
2627. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2628. gbpln1320.seq - Plant sequence entries (including fungi and algae), part 1320.
2629. gbpln1321.seq - Plant sequence entries (including fungi and algae), part 1321.
2630. gbpln1322.seq - Plant sequence entries (including fungi and algae), part 1322.
2631. gbpln1323.seq - Plant sequence entries (including fungi and algae), part 1323.
2632. gbpln1324.seq - Plant sequence entries (including fungi and algae), part 1324.
2633. gbpln1325.seq - Plant sequence entries (including fungi and algae), part 1325.
2634. gbpln1326.seq - Plant sequence entries (including fungi and algae), part 1326.
2635. gbpln1327.seq - Plant sequence entries (including fungi and algae), part 1327.
2636. gbpln1328.seq - Plant sequence entries (including fungi and algae), part 1328.
2637. gbpln1329.seq - Plant sequence entries (including fungi and algae), part 1329.
2638. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2639. gbpln1330.seq - Plant sequence entries (including fungi and algae), part 1330.
2640. gbpln1331.seq - Plant sequence entries (including fungi and algae), part 1331.
2641. gbpln1332.seq - Plant sequence entries (including fungi and algae), part 1332.
2642. gbpln1333.seq - Plant sequence entries (including fungi and algae), part 1333.
2643. gbpln1334.seq - Plant sequence entries (including fungi and algae), part 1334.
2644. gbpln1335.seq - Plant sequence entries (including fungi and algae), part 1335.
2645. gbpln1336.seq - Plant sequence entries (including fungi and algae), part 1336.
2646. gbpln1337.seq - Plant sequence entries (including fungi and algae), part 1337.
2647. gbpln1338.seq - Plant sequence entries (including fungi and algae), part 1338.
2648. gbpln1339.seq - Plant sequence entries (including fungi and algae), part 1339.
2649. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2650. gbpln1340.seq - Plant sequence entries (including fungi and algae), part 1340.
2651. gbpln1341.seq - Plant sequence entries (including fungi and algae), part 1341.
2652. gbpln1342.seq - Plant sequence entries (including fungi and algae), part 1342.
2653. gbpln1343.seq - Plant sequence entries (including fungi and algae), part 1343.
2654. gbpln1344.seq - Plant sequence entries (including fungi and algae), part 1344.
2655. gbpln1345.seq - Plant sequence entries (including fungi and algae), part 1345.
2656. gbpln1346.seq - Plant sequence entries (including fungi and algae), part 1346.
2657. gbpln1347.seq - Plant sequence entries (including fungi and algae), part 1347.
2658. gbpln1348.seq - Plant sequence entries (including fungi and algae), part 1348.
2659. gbpln1349.seq - Plant sequence entries (including fungi and algae), part 1349.
2660. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2661. gbpln1350.seq - Plant sequence entries (including fungi and algae), part 1350.
2662. gbpln1351.seq - Plant sequence entries (including fungi and algae), part 1351.
2663. gbpln1352.seq - Plant sequence entries (including fungi and algae), part 1352.
2664. gbpln1353.seq - Plant sequence entries (including fungi and algae), part 1353.
2665. gbpln1354.seq - Plant sequence entries (including fungi and algae), part 1354.
2666. gbpln1355.seq - Plant sequence entries (including fungi and algae), part 1355.
2667. gbpln1356.seq - Plant sequence entries (including fungi and algae), part 1356.
2668. gbpln1357.seq - Plant sequence entries (including fungi and algae), part 1357.
2669. gbpln1358.seq - Plant sequence entries (including fungi and algae), part 1358.
2670. gbpln1359.seq - Plant sequence entries (including fungi and algae), part 1359.
2671. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2672. gbpln1360.seq - Plant sequence entries (including fungi and algae), part 1360.
2673. gbpln1361.seq - Plant sequence entries (including fungi and algae), part 1361.
2674. gbpln1362.seq - Plant sequence entries (including fungi and algae), part 1362.
2675. gbpln1363.seq - Plant sequence entries (including fungi and algae), part 1363.
2676. gbpln1364.seq - Plant sequence entries (including fungi and algae), part 1364.
2677. gbpln1365.seq - Plant sequence entries (including fungi and algae), part 1365.
2678. gbpln1366.seq - Plant sequence entries (including fungi and algae), part 1366.
2679. gbpln1367.seq - Plant sequence entries (including fungi and algae), part 1367.
2680. gbpln1368.seq - Plant sequence entries (including fungi and algae), part 1368.
2681. gbpln1369.seq - Plant sequence entries (including fungi and algae), part 1369.
2682. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2683. gbpln1370.seq - Plant sequence entries (including fungi and algae), part 1370.
2684. gbpln1371.seq - Plant sequence entries (including fungi and algae), part 1371.
2685. gbpln1372.seq - Plant sequence entries (including fungi and algae), part 1372.
2686. gbpln1373.seq - Plant sequence entries (including fungi and algae), part 1373.
2687. gbpln1374.seq - Plant sequence entries (including fungi and algae), part 1374.
2688. gbpln1375.seq - Plant sequence entries (including fungi and algae), part 1375.
2689. gbpln1376.seq - Plant sequence entries (including fungi and algae), part 1376.
2690. gbpln1377.seq - Plant sequence entries (including fungi and algae), part 1377.
2691. gbpln1378.seq - Plant sequence entries (including fungi and algae), part 1378.
2692. gbpln1379.seq - Plant sequence entries (including fungi and algae), part 1379.
2693. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2694. gbpln1380.seq - Plant sequence entries (including fungi and algae), part 1380.
2695. gbpln1381.seq - Plant sequence entries (including fungi and algae), part 1381.
2696. gbpln1382.seq - Plant sequence entries (including fungi and algae), part 1382.
2697. gbpln1383.seq - Plant sequence entries (including fungi and algae), part 1383.
2698. gbpln1384.seq - Plant sequence entries (including fungi and algae), part 1384.
2699. gbpln1385.seq - Plant sequence entries (including fungi and algae), part 1385.
2700. gbpln1386.seq - Plant sequence entries (including fungi and algae), part 1386.
2701. gbpln1387.seq - Plant sequence entries (including fungi and algae), part 1387.
2702. gbpln1388.seq - Plant sequence entries (including fungi and algae), part 1388.
2703. gbpln1389.seq - Plant sequence entries (including fungi and algae), part 1389.
2704. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2705. gbpln1390.seq - Plant sequence entries (including fungi and algae), part 1390.
2706. gbpln1391.seq - Plant sequence entries (including fungi and algae), part 1391.
2707. gbpln1392.seq - Plant sequence entries (including fungi and algae), part 1392.
2708. gbpln1393.seq - Plant sequence entries (including fungi and algae), part 1393.
2709. gbpln1394.seq - Plant sequence entries (including fungi and algae), part 1394.
2710. gbpln1395.seq - Plant sequence entries (including fungi and algae), part 1395.
2711. gbpln1396.seq - Plant sequence entries (including fungi and algae), part 1396.
2712. gbpln1397.seq - Plant sequence entries (including fungi and algae), part 1397.
2713. gbpln1398.seq - Plant sequence entries (including fungi and algae), part 1398.
2714. gbpln1399.seq - Plant sequence entries (including fungi and algae), part 1399.
2715. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2716. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2717. gbpln1400.seq - Plant sequence entries (including fungi and algae), part 1400.
2718. gbpln1401.seq - Plant sequence entries (including fungi and algae), part 1401.
2719. gbpln1402.seq - Plant sequence entries (including fungi and algae), part 1402.
2720. gbpln1403.seq - Plant sequence entries (including fungi and algae), part 1403.
2721. gbpln1404.seq - Plant sequence entries (including fungi and algae), part 1404.
2722. gbpln1405.seq - Plant sequence entries (including fungi and algae), part 1405.
2723. gbpln1406.seq - Plant sequence entries (including fungi and algae), part 1406.
2724. gbpln1407.seq - Plant sequence entries (including fungi and algae), part 1407.
2725. gbpln1408.seq - Plant sequence entries (including fungi and algae), part 1408.
2726. gbpln1409.seq - Plant sequence entries (including fungi and algae), part 1409.
2727. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2728. gbpln1410.seq - Plant sequence entries (including fungi and algae), part 1410.
2729. gbpln1411.seq - Plant sequence entries (including fungi and algae), part 1411.
2730. gbpln1412.seq - Plant sequence entries (including fungi and algae), part 1412.
2731. gbpln1413.seq - Plant sequence entries (including fungi and algae), part 1413.
2732. gbpln1414.seq - Plant sequence entries (including fungi and algae), part 1414.
2733. gbpln1415.seq - Plant sequence entries (including fungi and algae), part 1415.
2734. gbpln1416.seq - Plant sequence entries (including fungi and algae), part 1416.
2735. gbpln1417.seq - Plant sequence entries (including fungi and algae), part 1417.
2736. gbpln1418.seq - Plant sequence entries (including fungi and algae), part 1418.
2737. gbpln1419.seq - Plant sequence entries (including fungi and algae), part 1419.
2738. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2739. gbpln1420.seq - Plant sequence entries (including fungi and algae), part 1420.
2740. gbpln1421.seq - Plant sequence entries (including fungi and algae), part 1421.
2741. gbpln1422.seq - Plant sequence entries (including fungi and algae), part 1422.
2742. gbpln1423.seq - Plant sequence entries (including fungi and algae), part 1423.
2743. gbpln1424.seq - Plant sequence entries (including fungi and algae), part 1424.
2744. gbpln1425.seq - Plant sequence entries (including fungi and algae), part 1425.
2745. gbpln1426.seq - Plant sequence entries (including fungi and algae), part 1426.
2746. gbpln1427.seq - Plant sequence entries (including fungi and algae), part 1427.
2747. gbpln1428.seq - Plant sequence entries (including fungi and algae), part 1428.
2748. gbpln1429.seq - Plant sequence entries (including fungi and algae), part 1429.
2749. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2750. gbpln1430.seq - Plant sequence entries (including fungi and algae), part 1430.
2751. gbpln1431.seq - Plant sequence entries (including fungi and algae), part 1431.
2752. gbpln1432.seq - Plant sequence entries (including fungi and algae), part 1432.
2753. gbpln1433.seq - Plant sequence entries (including fungi and algae), part 1433.
2754. gbpln1434.seq - Plant sequence entries (including fungi and algae), part 1434.
2755. gbpln1435.seq - Plant sequence entries (including fungi and algae), part 1435.
2756. gbpln1436.seq - Plant sequence entries (including fungi and algae), part 1436.
2757. gbpln1437.seq - Plant sequence entries (including fungi and algae), part 1437.
2758. gbpln1438.seq - Plant sequence entries (including fungi and algae), part 1438.
2759. gbpln1439.seq - Plant sequence entries (including fungi and algae), part 1439.
2760. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2761. gbpln1440.seq - Plant sequence entries (including fungi and algae), part 1440.
2762. gbpln1441.seq - Plant sequence entries (including fungi and algae), part 1441.
2763. gbpln1442.seq - Plant sequence entries (including fungi and algae), part 1442.
2764. gbpln1443.seq - Plant sequence entries (including fungi and algae), part 1443.
2765. gbpln1444.seq - Plant sequence entries (including fungi and algae), part 1444.
2766. gbpln1445.seq - Plant sequence entries (including fungi and algae), part 1445.
2767. gbpln1446.seq - Plant sequence entries (including fungi and algae), part 1446.
2768. gbpln1447.seq - Plant sequence entries (including fungi and algae), part 1447.
2769. gbpln1448.seq - Plant sequence entries (including fungi and algae), part 1448.
2770. gbpln1449.seq - Plant sequence entries (including fungi and algae), part 1449.
2771. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2772. gbpln1450.seq - Plant sequence entries (including fungi and algae), part 1450.
2773. gbpln1451.seq - Plant sequence entries (including fungi and algae), part 1451.
2774. gbpln1452.seq - Plant sequence entries (including fungi and algae), part 1452.
2775. gbpln1453.seq - Plant sequence entries (including fungi and algae), part 1453.
2776. gbpln1454.seq - Plant sequence entries (including fungi and algae), part 1454.
2777. gbpln1455.seq - Plant sequence entries (including fungi and algae), part 1455.
2778. gbpln1456.seq - Plant sequence entries (including fungi and algae), part 1456.
2779. gbpln1457.seq - Plant sequence entries (including fungi and algae), part 1457.
2780. gbpln1458.seq - Plant sequence entries (including fungi and algae), part 1458.
2781. gbpln1459.seq - Plant sequence entries (including fungi and algae), part 1459.
2782. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2783. gbpln1460.seq - Plant sequence entries (including fungi and algae), part 1460.
2784. gbpln1461.seq - Plant sequence entries (including fungi and algae), part 1461.
2785. gbpln1462.seq - Plant sequence entries (including fungi and algae), part 1462.
2786. gbpln1463.seq - Plant sequence entries (including fungi and algae), part 1463.
2787. gbpln1464.seq - Plant sequence entries (including fungi and algae), part 1464.
2788. gbpln1465.seq - Plant sequence entries (including fungi and algae), part 1465.
2789. gbpln1466.seq - Plant sequence entries (including fungi and algae), part 1466.
2790. gbpln1467.seq - Plant sequence entries (including fungi and algae), part 1467.
2791. gbpln1468.seq - Plant sequence entries (including fungi and algae), part 1468.
2792. gbpln1469.seq - Plant sequence entries (including fungi and algae), part 1469.
2793. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2794. gbpln1470.seq - Plant sequence entries (including fungi and algae), part 1470.
2795. gbpln1471.seq - Plant sequence entries (including fungi and algae), part 1471.
2796. gbpln1472.seq - Plant sequence entries (including fungi and algae), part 1472.
2797. gbpln1473.seq - Plant sequence entries (including fungi and algae), part 1473.
2798. gbpln1474.seq - Plant sequence entries (including fungi and algae), part 1474.
2799. gbpln1475.seq - Plant sequence entries (including fungi and algae), part 1475.
2800. gbpln1476.seq - Plant sequence entries (including fungi and algae), part 1476.
2801. gbpln1477.seq - Plant sequence entries (including fungi and algae), part 1477.
2802. gbpln1478.seq - Plant sequence entries (including fungi and algae), part 1478.
2803. gbpln1479.seq - Plant sequence entries (including fungi and algae), part 1479.
2804. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2805. gbpln1480.seq - Plant sequence entries (including fungi and algae), part 1480.
2806. gbpln1481.seq - Plant sequence entries (including fungi and algae), part 1481.
2807. gbpln1482.seq - Plant sequence entries (including fungi and algae), part 1482.
2808. gbpln1483.seq - Plant sequence entries (including fungi and algae), part 1483.
2809. gbpln1484.seq - Plant sequence entries (including fungi and algae), part 1484.
2810. gbpln1485.seq - Plant sequence entries (including fungi and algae), part 1485.
2811. gbpln1486.seq - Plant sequence entries (including fungi and algae), part 1486.
2812. gbpln1487.seq - Plant sequence entries (including fungi and algae), part 1487.
2813. gbpln1488.seq - Plant sequence entries (including fungi and algae), part 1488.
2814. gbpln1489.seq - Plant sequence entries (including fungi and algae), part 1489.
2815. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2816. gbpln1490.seq - Plant sequence entries (including fungi and algae), part 1490.
2817. gbpln1491.seq - Plant sequence entries (including fungi and algae), part 1491.
2818. gbpln1492.seq - Plant sequence entries (including fungi and algae), part 1492.
2819. gbpln1493.seq - Plant sequence entries (including fungi and algae), part 1493.
2820. gbpln1494.seq - Plant sequence entries (including fungi and algae), part 1494.
2821. gbpln1495.seq - Plant sequence entries (including fungi and algae), part 1495.
2822. gbpln1496.seq - Plant sequence entries (including fungi and algae), part 1496.
2823. gbpln1497.seq - Plant sequence entries (including fungi and algae), part 1497.
2824. gbpln1498.seq - Plant sequence entries (including fungi and algae), part 1498.
2825. gbpln1499.seq - Plant sequence entries (including fungi and algae), part 1499.
2826. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2827. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2828. gbpln1500.seq - Plant sequence entries (including fungi and algae), part 1500.
2829. gbpln1501.seq - Plant sequence entries (including fungi and algae), part 1501.
2830. gbpln1502.seq - Plant sequence entries (including fungi and algae), part 1502.
2831. gbpln1503.seq - Plant sequence entries (including fungi and algae), part 1503.
2832. gbpln1504.seq - Plant sequence entries (including fungi and algae), part 1504.
2833. gbpln1505.seq - Plant sequence entries (including fungi and algae), part 1505.
2834. gbpln1506.seq - Plant sequence entries (including fungi and algae), part 1506.
2835. gbpln1507.seq - Plant sequence entries (including fungi and algae), part 1507.
2836. gbpln1508.seq - Plant sequence entries (including fungi and algae), part 1508.
2837. gbpln1509.seq - Plant sequence entries (including fungi and algae), part 1509.
2838. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
2839. gbpln1510.seq - Plant sequence entries (including fungi and algae), part 1510.
2840. gbpln1511.seq - Plant sequence entries (including fungi and algae), part 1511.
2841. gbpln1512.seq - Plant sequence entries (including fungi and algae), part 1512.
2842. gbpln1513.seq - Plant sequence entries (including fungi and algae), part 1513.
2843. gbpln1514.seq - Plant sequence entries (including fungi and algae), part 1514.
2844. gbpln1515.seq - Plant sequence entries (including fungi and algae), part 1515.
2845. gbpln1516.seq - Plant sequence entries (including fungi and algae), part 1516.
2846. gbpln1517.seq - Plant sequence entries (including fungi and algae), part 1517.
2847. gbpln1518.seq - Plant sequence entries (including fungi and algae), part 1518.
2848. gbpln1519.seq - Plant sequence entries (including fungi and algae), part 1519.
2849. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2850. gbpln1520.seq - Plant sequence entries (including fungi and algae), part 1520.
2851. gbpln1521.seq - Plant sequence entries (including fungi and algae), part 1521.
2852. gbpln1522.seq - Plant sequence entries (including fungi and algae), part 1522.
2853. gbpln1523.seq - Plant sequence entries (including fungi and algae), part 1523.
2854. gbpln1524.seq - Plant sequence entries (including fungi and algae), part 1524.
2855. gbpln1525.seq - Plant sequence entries (including fungi and algae), part 1525.
2856. gbpln1526.seq - Plant sequence entries (including fungi and algae), part 1526.
2857. gbpln1527.seq - Plant sequence entries (including fungi and algae), part 1527.
2858. gbpln1528.seq - Plant sequence entries (including fungi and algae), part 1528.
2859. gbpln1529.seq - Plant sequence entries (including fungi and algae), part 1529.
2860. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2861. gbpln1530.seq - Plant sequence entries (including fungi and algae), part 1530.
2862. gbpln1531.seq - Plant sequence entries (including fungi and algae), part 1531.
2863. gbpln1532.seq - Plant sequence entries (including fungi and algae), part 1532.
2864. gbpln1533.seq - Plant sequence entries (including fungi and algae), part 1533.
2865. gbpln1534.seq - Plant sequence entries (including fungi and algae), part 1534.
2866. gbpln1535.seq - Plant sequence entries (including fungi and algae), part 1535.
2867. gbpln1536.seq - Plant sequence entries (including fungi and algae), part 1536.
2868. gbpln1537.seq - Plant sequence entries (including fungi and algae), part 1537.
2869. gbpln1538.seq - Plant sequence entries (including fungi and algae), part 1538.
2870. gbpln1539.seq - Plant sequence entries (including fungi and algae), part 1539.
2871. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2872. gbpln1540.seq - Plant sequence entries (including fungi and algae), part 1540.
2873. gbpln1541.seq - Plant sequence entries (including fungi and algae), part 1541.
2874. gbpln1542.seq - Plant sequence entries (including fungi and algae), part 1542.
2875. gbpln1543.seq - Plant sequence entries (including fungi and algae), part 1543.
2876. gbpln1544.seq - Plant sequence entries (including fungi and algae), part 1544.
2877. gbpln1545.seq - Plant sequence entries (including fungi and algae), part 1545.
2878. gbpln1546.seq - Plant sequence entries (including fungi and algae), part 1546.
2879. gbpln1547.seq - Plant sequence entries (including fungi and algae), part 1547.
2880. gbpln1548.seq - Plant sequence entries (including fungi and algae), part 1548.
2881. gbpln1549.seq - Plant sequence entries (including fungi and algae), part 1549.
2882. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2883. gbpln1550.seq - Plant sequence entries (including fungi and algae), part 1550.
2884. gbpln1551.seq - Plant sequence entries (including fungi and algae), part 1551.
2885. gbpln1552.seq - Plant sequence entries (including fungi and algae), part 1552.
2886. gbpln1553.seq - Plant sequence entries (including fungi and algae), part 1553.
2887. gbpln1554.seq - Plant sequence entries (including fungi and algae), part 1554.
2888. gbpln1555.seq - Plant sequence entries (including fungi and algae), part 1555.
2889. gbpln1556.seq - Plant sequence entries (including fungi and algae), part 1556.
2890. gbpln1557.seq - Plant sequence entries (including fungi and algae), part 1557.
2891. gbpln1558.seq - Plant sequence entries (including fungi and algae), part 1558.
2892. gbpln1559.seq - Plant sequence entries (including fungi and algae), part 1559.
2893. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
2894. gbpln1560.seq - Plant sequence entries (including fungi and algae), part 1560.
2895. gbpln1561.seq - Plant sequence entries (including fungi and algae), part 1561.
2896. gbpln1562.seq - Plant sequence entries (including fungi and algae), part 1562.
2897. gbpln1563.seq - Plant sequence entries (including fungi and algae), part 1563.
2898. gbpln1564.seq - Plant sequence entries (including fungi and algae), part 1564.
2899. gbpln1565.seq - Plant sequence entries (including fungi and algae), part 1565.
2900. gbpln1566.seq - Plant sequence entries (including fungi and algae), part 1566.
2901. gbpln1567.seq - Plant sequence entries (including fungi and algae), part 1567.
2902. gbpln1568.seq - Plant sequence entries (including fungi and algae), part 1568.
2903. gbpln1569.seq - Plant sequence entries (including fungi and algae), part 1569.
2904. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
2905. gbpln1570.seq - Plant sequence entries (including fungi and algae), part 1570.
2906. gbpln1571.seq - Plant sequence entries (including fungi and algae), part 1571.
2907. gbpln1572.seq - Plant sequence entries (including fungi and algae), part 1572.
2908. gbpln1573.seq - Plant sequence entries (including fungi and algae), part 1573.
2909. gbpln1574.seq - Plant sequence entries (including fungi and algae), part 1574.
2910. gbpln1575.seq - Plant sequence entries (including fungi and algae), part 1575.
2911. gbpln1576.seq - Plant sequence entries (including fungi and algae), part 1576.
2912. gbpln1577.seq - Plant sequence entries (including fungi and algae), part 1577.
2913. gbpln1578.seq - Plant sequence entries (including fungi and algae), part 1578.
2914. gbpln1579.seq - Plant sequence entries (including fungi and algae), part 1579.
2915. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
2916. gbpln1580.seq - Plant sequence entries (including fungi and algae), part 1580.
2917. gbpln1581.seq - Plant sequence entries (including fungi and algae), part 1581.
2918. gbpln1582.seq - Plant sequence entries (including fungi and algae), part 1582.
2919. gbpln1583.seq - Plant sequence entries (including fungi and algae), part 1583.
2920. gbpln1584.seq - Plant sequence entries (including fungi and algae), part 1584.
2921. gbpln1585.seq - Plant sequence entries (including fungi and algae), part 1585.
2922. gbpln1586.seq - Plant sequence entries (including fungi and algae), part 1586.
2923. gbpln1587.seq - Plant sequence entries (including fungi and algae), part 1587.
2924. gbpln1588.seq - Plant sequence entries (including fungi and algae), part 1588.
2925. gbpln1589.seq - Plant sequence entries (including fungi and algae), part 1589.
2926. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
2927. gbpln1590.seq - Plant sequence entries (including fungi and algae), part 1590.
2928. gbpln1591.seq - Plant sequence entries (including fungi and algae), part 1591.
2929. gbpln1592.seq - Plant sequence entries (including fungi and algae), part 1592.
2930. gbpln1593.seq - Plant sequence entries (including fungi and algae), part 1593.
2931. gbpln1594.seq - Plant sequence entries (including fungi and algae), part 1594.
2932. gbpln1595.seq - Plant sequence entries (including fungi and algae), part 1595.
2933. gbpln1596.seq - Plant sequence entries (including fungi and algae), part 1596.
2934. gbpln1597.seq - Plant sequence entries (including fungi and algae), part 1597.
2935. gbpln1598.seq - Plant sequence entries (including fungi and algae), part 1598.
2936. gbpln1599.seq - Plant sequence entries (including fungi and algae), part 1599.
2937. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2938. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
2939. gbpln1600.seq - Plant sequence entries (including fungi and algae), part 1600.
2940. gbpln1601.seq - Plant sequence entries (including fungi and algae), part 1601.
2941. gbpln1602.seq - Plant sequence entries (including fungi and algae), part 1602.
2942. gbpln1603.seq - Plant sequence entries (including fungi and algae), part 1603.
2943. gbpln1604.seq - Plant sequence entries (including fungi and algae), part 1604.
2944. gbpln1605.seq - Plant sequence entries (including fungi and algae), part 1605.
2945. gbpln1606.seq - Plant sequence entries (including fungi and algae), part 1606.
2946. gbpln1607.seq - Plant sequence entries (including fungi and algae), part 1607.
2947. gbpln1608.seq - Plant sequence entries (including fungi and algae), part 1608.
2948. gbpln1609.seq - Plant sequence entries (including fungi and algae), part 1609.
2949. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
2950. gbpln1610.seq - Plant sequence entries (including fungi and algae), part 1610.
2951. gbpln1611.seq - Plant sequence entries (including fungi and algae), part 1611.
2952. gbpln1612.seq - Plant sequence entries (including fungi and algae), part 1612.
2953. gbpln1613.seq - Plant sequence entries (including fungi and algae), part 1613.
2954. gbpln1614.seq - Plant sequence entries (including fungi and algae), part 1614.
2955. gbpln1615.seq - Plant sequence entries (including fungi and algae), part 1615.
2956. gbpln1616.seq - Plant sequence entries (including fungi and algae), part 1616.
2957. gbpln1617.seq - Plant sequence entries (including fungi and algae), part 1617.
2958. gbpln1618.seq - Plant sequence entries (including fungi and algae), part 1618.
2959. gbpln1619.seq - Plant sequence entries (including fungi and algae), part 1619.
2960. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
2961. gbpln1620.seq - Plant sequence entries (including fungi and algae), part 1620.
2962. gbpln1621.seq - Plant sequence entries (including fungi and algae), part 1621.
2963. gbpln1622.seq - Plant sequence entries (including fungi and algae), part 1622.
2964. gbpln1623.seq - Plant sequence entries (including fungi and algae), part 1623.
2965. gbpln1624.seq - Plant sequence entries (including fungi and algae), part 1624.
2966. gbpln1625.seq - Plant sequence entries (including fungi and algae), part 1625.
2967. gbpln1626.seq - Plant sequence entries (including fungi and algae), part 1626.
2968. gbpln1627.seq - Plant sequence entries (including fungi and algae), part 1627.
2969. gbpln1628.seq - Plant sequence entries (including fungi and algae), part 1628.
2970. gbpln1629.seq - Plant sequence entries (including fungi and algae), part 1629.
2971. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
2972. gbpln1630.seq - Plant sequence entries (including fungi and algae), part 1630.
2973. gbpln1631.seq - Plant sequence entries (including fungi and algae), part 1631.
2974. gbpln1632.seq - Plant sequence entries (including fungi and algae), part 1632.
2975. gbpln1633.seq - Plant sequence entries (including fungi and algae), part 1633.
2976. gbpln1634.seq - Plant sequence entries (including fungi and algae), part 1634.
2977. gbpln1635.seq - Plant sequence entries (including fungi and algae), part 1635.
2978. gbpln1636.seq - Plant sequence entries (including fungi and algae), part 1636.
2979. gbpln1637.seq - Plant sequence entries (including fungi and algae), part 1637.
2980. gbpln1638.seq - Plant sequence entries (including fungi and algae), part 1638.
2981. gbpln1639.seq - Plant sequence entries (including fungi and algae), part 1639.
2982. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
2983. gbpln1640.seq - Plant sequence entries (including fungi and algae), part 1640.
2984. gbpln1641.seq - Plant sequence entries (including fungi and algae), part 1641.
2985. gbpln1642.seq - Plant sequence entries (including fungi and algae), part 1642.
2986. gbpln1643.seq - Plant sequence entries (including fungi and algae), part 1643.
2987. gbpln1644.seq - Plant sequence entries (including fungi and algae), part 1644.
2988. gbpln1645.seq - Plant sequence entries (including fungi and algae), part 1645.
2989. gbpln1646.seq - Plant sequence entries (including fungi and algae), part 1646.
2990. gbpln1647.seq - Plant sequence entries (including fungi and algae), part 1647.
2991. gbpln1648.seq - Plant sequence entries (including fungi and algae), part 1648.
2992. gbpln1649.seq - Plant sequence entries (including fungi and algae), part 1649.
2993. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
2994. gbpln1650.seq - Plant sequence entries (including fungi and algae), part 1650.
2995. gbpln1651.seq - Plant sequence entries (including fungi and algae), part 1651.
2996. gbpln1652.seq - Plant sequence entries (including fungi and algae), part 1652.
2997. gbpln1653.seq - Plant sequence entries (including fungi and algae), part 1653.
2998. gbpln1654.seq - Plant sequence entries (including fungi and algae), part 1654.
2999. gbpln1655.seq - Plant sequence entries (including fungi and algae), part 1655.
3000. gbpln1656.seq - Plant sequence entries (including fungi and algae), part 1656.
3001. gbpln1657.seq - Plant sequence entries (including fungi and algae), part 1657.
3002. gbpln1658.seq - Plant sequence entries (including fungi and algae), part 1658.
3003. gbpln1659.seq - Plant sequence entries (including fungi and algae), part 1659.
3004. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
3005. gbpln1660.seq - Plant sequence entries (including fungi and algae), part 1660.
3006. gbpln1661.seq - Plant sequence entries (including fungi and algae), part 1661.
3007. gbpln1662.seq - Plant sequence entries (including fungi and algae), part 1662.
3008. gbpln1663.seq - Plant sequence entries (including fungi and algae), part 1663.
3009. gbpln1664.seq - Plant sequence entries (including fungi and algae), part 1664.
3010. gbpln1665.seq - Plant sequence entries (including fungi and algae), part 1665.
3011. gbpln1666.seq - Plant sequence entries (including fungi and algae), part 1666.
3012. gbpln1667.seq - Plant sequence entries (including fungi and algae), part 1667.
3013. gbpln1668.seq - Plant sequence entries (including fungi and algae), part 1668.
3014. gbpln1669.seq - Plant sequence entries (including fungi and algae), part 1669.
3015. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
3016. gbpln1670.seq - Plant sequence entries (including fungi and algae), part 1670.
3017. gbpln1671.seq - Plant sequence entries (including fungi and algae), part 1671.
3018. gbpln1672.seq - Plant sequence entries (including fungi and algae), part 1672.
3019. gbpln1673.seq - Plant sequence entries (including fungi and algae), part 1673.
3020. gbpln1674.seq - Plant sequence entries (including fungi and algae), part 1674.
3021. gbpln1675.seq - Plant sequence entries (including fungi and algae), part 1675.
3022. gbpln1676.seq - Plant sequence entries (including fungi and algae), part 1676.
3023. gbpln1677.seq - Plant sequence entries (including fungi and algae), part 1677.
3024. gbpln1678.seq - Plant sequence entries (including fungi and algae), part 1678.
3025. gbpln1679.seq - Plant sequence entries (including fungi and algae), part 1679.
3026. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
3027. gbpln1680.seq - Plant sequence entries (including fungi and algae), part 1680.
3028. gbpln1681.seq - Plant sequence entries (including fungi and algae), part 1681.
3029. gbpln1682.seq - Plant sequence entries (including fungi and algae), part 1682.
3030. gbpln1683.seq - Plant sequence entries (including fungi and algae), part 1683.
3031. gbpln1684.seq - Plant sequence entries (including fungi and algae), part 1684.
3032. gbpln1685.seq - Plant sequence entries (including fungi and algae), part 1685.
3033. gbpln1686.seq - Plant sequence entries (including fungi and algae), part 1686.
3034. gbpln1687.seq - Plant sequence entries (including fungi and algae), part 1687.
3035. gbpln1688.seq - Plant sequence entries (including fungi and algae), part 1688.
3036. gbpln1689.seq - Plant sequence entries (including fungi and algae), part 1689.
3037. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
3038. gbpln1690.seq - Plant sequence entries (including fungi and algae), part 1690.
3039. gbpln1691.seq - Plant sequence entries (including fungi and algae), part 1691.
3040. gbpln1692.seq - Plant sequence entries (including fungi and algae), part 1692.
3041. gbpln1693.seq - Plant sequence entries (including fungi and algae), part 1693.
3042. gbpln1694.seq - Plant sequence entries (including fungi and algae), part 1694.
3043. gbpln1695.seq - Plant sequence entries (including fungi and algae), part 1695.
3044. gbpln1696.seq - Plant sequence entries (including fungi and algae), part 1696.
3045. gbpln1697.seq - Plant sequence entries (including fungi and algae), part 1697.
3046. gbpln1698.seq - Plant sequence entries (including fungi and algae), part 1698.
3047. gbpln1699.seq - Plant sequence entries (including fungi and algae), part 1699.
3048. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
3049. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
3050. gbpln1700.seq - Plant sequence entries (including fungi and algae), part 1700.
3051. gbpln1701.seq - Plant sequence entries (including fungi and algae), part 1701.
3052. gbpln1702.seq - Plant sequence entries (including fungi and algae), part 1702.
3053. gbpln1703.seq - Plant sequence entries (including fungi and algae), part 1703.
3054. gbpln1704.seq - Plant sequence entries (including fungi and algae), part 1704.
3055. gbpln1705.seq - Plant sequence entries (including fungi and algae), part 1705.
3056. gbpln1706.seq - Plant sequence entries (including fungi and algae), part 1706.
3057. gbpln1707.seq - Plant sequence entries (including fungi and algae), part 1707.
3058. gbpln1708.seq - Plant sequence entries (including fungi and algae), part 1708.
3059. gbpln1709.seq - Plant sequence entries (including fungi and algae), part 1709.
3060. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
3061. gbpln1710.seq - Plant sequence entries (including fungi and algae), part 1710.
3062. gbpln1711.seq - Plant sequence entries (including fungi and algae), part 1711.
3063. gbpln1712.seq - Plant sequence entries (including fungi and algae), part 1712.
3064. gbpln1713.seq - Plant sequence entries (including fungi and algae), part 1713.
3065. gbpln1714.seq - Plant sequence entries (including fungi and algae), part 1714.
3066. gbpln1715.seq - Plant sequence entries (including fungi and algae), part 1715.
3067. gbpln1716.seq - Plant sequence entries (including fungi and algae), part 1716.
3068. gbpln1717.seq - Plant sequence entries (including fungi and algae), part 1717.
3069. gbpln1718.seq - Plant sequence entries (including fungi and algae), part 1718.
3070. gbpln1719.seq - Plant sequence entries (including fungi and algae), part 1719.
3071. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
3072. gbpln1720.seq - Plant sequence entries (including fungi and algae), part 1720.
3073. gbpln1721.seq - Plant sequence entries (including fungi and algae), part 1721.
3074. gbpln1722.seq - Plant sequence entries (including fungi and algae), part 1722.
3075. gbpln1723.seq - Plant sequence entries (including fungi and algae), part 1723.
3076. gbpln1724.seq - Plant sequence entries (including fungi and algae), part 1724.
3077. gbpln1725.seq - Plant sequence entries (including fungi and algae), part 1725.
3078. gbpln1726.seq - Plant sequence entries (including fungi and algae), part 1726.
3079. gbpln1727.seq - Plant sequence entries (including fungi and algae), part 1727.
3080. gbpln1728.seq - Plant sequence entries (including fungi and algae), part 1728.
3081. gbpln1729.seq - Plant sequence entries (including fungi and algae), part 1729.
3082. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
3083. gbpln1730.seq - Plant sequence entries (including fungi and algae), part 1730.
3084. gbpln1731.seq - Plant sequence entries (including fungi and algae), part 1731.
3085. gbpln1732.seq - Plant sequence entries (including fungi and algae), part 1732.
3086. gbpln1733.seq - Plant sequence entries (including fungi and algae), part 1733.
3087. gbpln1734.seq - Plant sequence entries (including fungi and algae), part 1734.
3088. gbpln1735.seq - Plant sequence entries (including fungi and algae), part 1735.
3089. gbpln1736.seq - Plant sequence entries (including fungi and algae), part 1736.
3090. gbpln1737.seq - Plant sequence entries (including fungi and algae), part 1737.
3091. gbpln1738.seq - Plant sequence entries (including fungi and algae), part 1738.
3092. gbpln1739.seq - Plant sequence entries (including fungi and algae), part 1739.
3093. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
3094. gbpln1740.seq - Plant sequence entries (including fungi and algae), part 1740.
3095. gbpln1741.seq - Plant sequence entries (including fungi and algae), part 1741.
3096. gbpln1742.seq - Plant sequence entries (including fungi and algae), part 1742.
3097. gbpln1743.seq - Plant sequence entries (including fungi and algae), part 1743.
3098. gbpln1744.seq - Plant sequence entries (including fungi and algae), part 1744.
3099. gbpln1745.seq - Plant sequence entries (including fungi and algae), part 1745.
3100. gbpln1746.seq - Plant sequence entries (including fungi and algae), part 1746.
3101. gbpln1747.seq - Plant sequence entries (including fungi and algae), part 1747.
3102. gbpln1748.seq - Plant sequence entries (including fungi and algae), part 1748.
3103. gbpln1749.seq - Plant sequence entries (including fungi and algae), part 1749.
3104. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
3105. gbpln1750.seq - Plant sequence entries (including fungi and algae), part 1750.
3106. gbpln1751.seq - Plant sequence entries (including fungi and algae), part 1751.
3107. gbpln1752.seq - Plant sequence entries (including fungi and algae), part 1752.
3108. gbpln1753.seq - Plant sequence entries (including fungi and algae), part 1753.
3109. gbpln1754.seq - Plant sequence entries (including fungi and algae), part 1754.
3110. gbpln1755.seq - Plant sequence entries (including fungi and algae), part 1755.
3111. gbpln1756.seq - Plant sequence entries (including fungi and algae), part 1756.
3112. gbpln1757.seq - Plant sequence entries (including fungi and algae), part 1757.
3113. gbpln1758.seq - Plant sequence entries (including fungi and algae), part 1758.
3114. gbpln1759.seq - Plant sequence entries (including fungi and algae), part 1759.
3115. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
3116. gbpln1760.seq - Plant sequence entries (including fungi and algae), part 1760.
3117. gbpln1761.seq - Plant sequence entries (including fungi and algae), part 1761.
3118. gbpln1762.seq - Plant sequence entries (including fungi and algae), part 1762.
3119. gbpln1763.seq - Plant sequence entries (including fungi and algae), part 1763.
3120. gbpln1764.seq - Plant sequence entries (including fungi and algae), part 1764.
3121. gbpln1765.seq - Plant sequence entries (including fungi and algae), part 1765.
3122. gbpln1766.seq - Plant sequence entries (including fungi and algae), part 1766.
3123. gbpln1767.seq - Plant sequence entries (including fungi and algae), part 1767.
3124. gbpln1768.seq - Plant sequence entries (including fungi and algae), part 1768.
3125. gbpln1769.seq - Plant sequence entries (including fungi and algae), part 1769.
3126. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
3127. gbpln1770.seq - Plant sequence entries (including fungi and algae), part 1770.
3128. gbpln1771.seq - Plant sequence entries (including fungi and algae), part 1771.
3129. gbpln1772.seq - Plant sequence entries (including fungi and algae), part 1772.
3130. gbpln1773.seq - Plant sequence entries (including fungi and algae), part 1773.
3131. gbpln1774.seq - Plant sequence entries (including fungi and algae), part 1774.
3132. gbpln1775.seq - Plant sequence entries (including fungi and algae), part 1775.
3133. gbpln1776.seq - Plant sequence entries (including fungi and algae), part 1776.
3134. gbpln1777.seq - Plant sequence entries (including fungi and algae), part 1777.
3135. gbpln1778.seq - Plant sequence entries (including fungi and algae), part 1778.
3136. gbpln1779.seq - Plant sequence entries (including fungi and algae), part 1779.
3137. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
3138. gbpln1780.seq - Plant sequence entries (including fungi and algae), part 1780.
3139. gbpln1781.seq - Plant sequence entries (including fungi and algae), part 1781.
3140. gbpln1782.seq - Plant sequence entries (including fungi and algae), part 1782.
3141. gbpln1783.seq - Plant sequence entries (including fungi and algae), part 1783.
3142. gbpln1784.seq - Plant sequence entries (including fungi and algae), part 1784.
3143. gbpln1785.seq - Plant sequence entries (including fungi and algae), part 1785.
3144. gbpln1786.seq - Plant sequence entries (including fungi and algae), part 1786.
3145. gbpln1787.seq - Plant sequence entries (including fungi and algae), part 1787.
3146. gbpln1788.seq - Plant sequence entries (including fungi and algae), part 1788.
3147. gbpln1789.seq - Plant sequence entries (including fungi and algae), part 1789.
3148. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
3149. gbpln1790.seq - Plant sequence entries (including fungi and algae), part 1790.
3150. gbpln1791.seq - Plant sequence entries (including fungi and algae), part 1791.
3151. gbpln1792.seq - Plant sequence entries (including fungi and algae), part 1792.
3152. gbpln1793.seq - Plant sequence entries (including fungi and algae), part 1793.
3153. gbpln1794.seq - Plant sequence entries (including fungi and algae), part 1794.
3154. gbpln1795.seq - Plant sequence entries (including fungi and algae), part 1795.
3155. gbpln1796.seq - Plant sequence entries (including fungi and algae), part 1796.
3156. gbpln1797.seq - Plant sequence entries (including fungi and algae), part 1797.
3157. gbpln1798.seq - Plant sequence entries (including fungi and algae), part 1798.
3158. gbpln1799.seq - Plant sequence entries (including fungi and algae), part 1799.
3159. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
3160. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
3161. gbpln1800.seq - Plant sequence entries (including fungi and algae), part 1800.
3162. gbpln1801.seq - Plant sequence entries (including fungi and algae), part 1801.
3163. gbpln1802.seq - Plant sequence entries (including fungi and algae), part 1802.
3164. gbpln1803.seq - Plant sequence entries (including fungi and algae), part 1803.
3165. gbpln1804.seq - Plant sequence entries (including fungi and algae), part 1804.
3166. gbpln1805.seq - Plant sequence entries (including fungi and algae), part 1805.
3167. gbpln1806.seq - Plant sequence entries (including fungi and algae), part 1806.
3168. gbpln1807.seq - Plant sequence entries (including fungi and algae), part 1807.
3169. gbpln1808.seq - Plant sequence entries (including fungi and algae), part 1808.
3170. gbpln1809.seq - Plant sequence entries (including fungi and algae), part 1809.
3171. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
3172. gbpln1810.seq - Plant sequence entries (including fungi and algae), part 1810.
3173. gbpln1811.seq - Plant sequence entries (including fungi and algae), part 1811.
3174. gbpln1812.seq - Plant sequence entries (including fungi and algae), part 1812.
3175. gbpln1813.seq - Plant sequence entries (including fungi and algae), part 1813.
3176. gbpln1814.seq - Plant sequence entries (including fungi and algae), part 1814.
3177. gbpln1815.seq - Plant sequence entries (including fungi and algae), part 1815.
3178. gbpln1816.seq - Plant sequence entries (including fungi and algae), part 1816.
3179. gbpln1817.seq - Plant sequence entries (including fungi and algae), part 1817.
3180. gbpln1818.seq - Plant sequence entries (including fungi and algae), part 1818.
3181. gbpln1819.seq - Plant sequence entries (including fungi and algae), part 1819.
3182. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
3183. gbpln1820.seq - Plant sequence entries (including fungi and algae), part 1820.
3184. gbpln1821.seq - Plant sequence entries (including fungi and algae), part 1821.
3185. gbpln1822.seq - Plant sequence entries (including fungi and algae), part 1822.
3186. gbpln1823.seq - Plant sequence entries (including fungi and algae), part 1823.
3187. gbpln1824.seq - Plant sequence entries (including fungi and algae), part 1824.
3188. gbpln1825.seq - Plant sequence entries (including fungi and algae), part 1825.
3189. gbpln1826.seq - Plant sequence entries (including fungi and algae), part 1826.
3190. gbpln1827.seq - Plant sequence entries (including fungi and algae), part 1827.
3191. gbpln1828.seq - Plant sequence entries (including fungi and algae), part 1828.
3192. gbpln1829.seq - Plant sequence entries (including fungi and algae), part 1829.
3193. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
3194. gbpln1830.seq - Plant sequence entries (including fungi and algae), part 1830.
3195. gbpln1831.seq - Plant sequence entries (including fungi and algae), part 1831.
3196. gbpln1832.seq - Plant sequence entries (including fungi and algae), part 1832.
3197. gbpln1833.seq - Plant sequence entries (including fungi and algae), part 1833.
3198. gbpln1834.seq - Plant sequence entries (including fungi and algae), part 1834.
3199. gbpln1835.seq - Plant sequence entries (including fungi and algae), part 1835.
3200. gbpln1836.seq - Plant sequence entries (including fungi and algae), part 1836.
3201. gbpln1837.seq - Plant sequence entries (including fungi and algae), part 1837.
3202. gbpln1838.seq - Plant sequence entries (including fungi and algae), part 1838.
3203. gbpln1839.seq - Plant sequence entries (including fungi and algae), part 1839.
3204. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
3205. gbpln1840.seq - Plant sequence entries (including fungi and algae), part 1840.
3206. gbpln1841.seq - Plant sequence entries (including fungi and algae), part 1841.
3207. gbpln1842.seq - Plant sequence entries (including fungi and algae), part 1842.
3208. gbpln1843.seq - Plant sequence entries (including fungi and algae), part 1843.
3209. gbpln1844.seq - Plant sequence entries (including fungi and algae), part 1844.
3210. gbpln1845.seq - Plant sequence entries (including fungi and algae), part 1845.
3211. gbpln1846.seq - Plant sequence entries (including fungi and algae), part 1846.
3212. gbpln1847.seq - Plant sequence entries (including fungi and algae), part 1847.
3213. gbpln1848.seq - Plant sequence entries (including fungi and algae), part 1848.
3214. gbpln1849.seq - Plant sequence entries (including fungi and algae), part 1849.
3215. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
3216. gbpln1850.seq - Plant sequence entries (including fungi and algae), part 1850.
3217. gbpln1851.seq - Plant sequence entries (including fungi and algae), part 1851.
3218. gbpln1852.seq - Plant sequence entries (including fungi and algae), part 1852.
3219. gbpln1853.seq - Plant sequence entries (including fungi and algae), part 1853.
3220. gbpln1854.seq - Plant sequence entries (including fungi and algae), part 1854.
3221. gbpln1855.seq - Plant sequence entries (including fungi and algae), part 1855.
3222. gbpln1856.seq - Plant sequence entries (including fungi and algae), part 1856.
3223. gbpln1857.seq - Plant sequence entries (including fungi and algae), part 1857.
3224. gbpln1858.seq - Plant sequence entries (including fungi and algae), part 1858.
3225. gbpln1859.seq - Plant sequence entries (including fungi and algae), part 1859.
3226. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
3227. gbpln1860.seq - Plant sequence entries (including fungi and algae), part 1860.
3228. gbpln1861.seq - Plant sequence entries (including fungi and algae), part 1861.
3229. gbpln1862.seq - Plant sequence entries (including fungi and algae), part 1862.
3230. gbpln1863.seq - Plant sequence entries (including fungi and algae), part 1863.
3231. gbpln1864.seq - Plant sequence entries (including fungi and algae), part 1864.
3232. gbpln1865.seq - Plant sequence entries (including fungi and algae), part 1865.
3233. gbpln1866.seq - Plant sequence entries (including fungi and algae), part 1866.
3234. gbpln1867.seq - Plant sequence entries (including fungi and algae), part 1867.
3235. gbpln1868.seq - Plant sequence entries (including fungi and algae), part 1868.
3236. gbpln1869.seq - Plant sequence entries (including fungi and algae), part 1869.
3237. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
3238. gbpln1870.seq - Plant sequence entries (including fungi and algae), part 1870.
3239. gbpln1871.seq - Plant sequence entries (including fungi and algae), part 1871.
3240. gbpln1872.seq - Plant sequence entries (including fungi and algae), part 1872.
3241. gbpln1873.seq - Plant sequence entries (including fungi and algae), part 1873.
3242. gbpln1874.seq - Plant sequence entries (including fungi and algae), part 1874.
3243. gbpln1875.seq - Plant sequence entries (including fungi and algae), part 1875.
3244. gbpln1876.seq - Plant sequence entries (including fungi and algae), part 1876.
3245. gbpln1877.seq - Plant sequence entries (including fungi and algae), part 1877.
3246. gbpln1878.seq - Plant sequence entries (including fungi and algae), part 1878.
3247. gbpln1879.seq - Plant sequence entries (including fungi and algae), part 1879.
3248. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
3249. gbpln1880.seq - Plant sequence entries (including fungi and algae), part 1880.
3250. gbpln1881.seq - Plant sequence entries (including fungi and algae), part 1881.
3251. gbpln1882.seq - Plant sequence entries (including fungi and algae), part 1882.
3252. gbpln1883.seq - Plant sequence entries (including fungi and algae), part 1883.
3253. gbpln1884.seq - Plant sequence entries (including fungi and algae), part 1884.
3254. gbpln1885.seq - Plant sequence entries (including fungi and algae), part 1885.
3255. gbpln1886.seq - Plant sequence entries (including fungi and algae), part 1886.
3256. gbpln1887.seq - Plant sequence entries (including fungi and algae), part 1887.
3257. gbpln1888.seq - Plant sequence entries (including fungi and algae), part 1888.
3258. gbpln1889.seq - Plant sequence entries (including fungi and algae), part 1889.
3259. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
3260. gbpln1890.seq - Plant sequence entries (including fungi and algae), part 1890.
3261. gbpln1891.seq - Plant sequence entries (including fungi and algae), part 1891.
3262. gbpln1892.seq - Plant sequence entries (including fungi and algae), part 1892.
3263. gbpln1893.seq - Plant sequence entries (including fungi and algae), part 1893.
3264. gbpln1894.seq - Plant sequence entries (including fungi and algae), part 1894.
3265. gbpln1895.seq - Plant sequence entries (including fungi and algae), part 1895.
3266. gbpln1896.seq - Plant sequence entries (including fungi and algae), part 1896.
3267. gbpln1897.seq - Plant sequence entries (including fungi and algae), part 1897.
3268. gbpln1898.seq - Plant sequence entries (including fungi and algae), part 1898.
3269. gbpln1899.seq - Plant sequence entries (including fungi and algae), part 1899.
3270. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
3271. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
3272. gbpln1900.seq - Plant sequence entries (including fungi and algae), part 1900.
3273. gbpln1901.seq - Plant sequence entries (including fungi and algae), part 1901.
3274. gbpln1902.seq - Plant sequence entries (including fungi and algae), part 1902.
3275. gbpln1903.seq - Plant sequence entries (including fungi and algae), part 1903.
3276. gbpln1904.seq - Plant sequence entries (including fungi and algae), part 1904.
3277. gbpln1905.seq - Plant sequence entries (including fungi and algae), part 1905.
3278. gbpln1906.seq - Plant sequence entries (including fungi and algae), part 1906.
3279. gbpln1907.seq - Plant sequence entries (including fungi and algae), part 1907.
3280. gbpln1908.seq - Plant sequence entries (including fungi and algae), part 1908.
3281. gbpln1909.seq - Plant sequence entries (including fungi and algae), part 1909.
3282. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
3283. gbpln1910.seq - Plant sequence entries (including fungi and algae), part 1910.
3284. gbpln1911.seq - Plant sequence entries (including fungi and algae), part 1911.
3285. gbpln1912.seq - Plant sequence entries (including fungi and algae), part 1912.
3286. gbpln1913.seq - Plant sequence entries (including fungi and algae), part 1913.
3287. gbpln1914.seq - Plant sequence entries (including fungi and algae), part 1914.
3288. gbpln1915.seq - Plant sequence entries (including fungi and algae), part 1915.
3289. gbpln1916.seq - Plant sequence entries (including fungi and algae), part 1916.
3290. gbpln1917.seq - Plant sequence entries (including fungi and algae), part 1917.
3291. gbpln1918.seq - Plant sequence entries (including fungi and algae), part 1918.
3292. gbpln1919.seq - Plant sequence entries (including fungi and algae), part 1919.
3293. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
3294. gbpln1920.seq - Plant sequence entries (including fungi and algae), part 1920.
3295. gbpln1921.seq - Plant sequence entries (including fungi and algae), part 1921.
3296. gbpln1922.seq - Plant sequence entries (including fungi and algae), part 1922.
3297. gbpln1923.seq - Plant sequence entries (including fungi and algae), part 1923.
3298. gbpln1924.seq - Plant sequence entries (including fungi and algae), part 1924.
3299. gbpln1925.seq - Plant sequence entries (including fungi and algae), part 1925.
3300. gbpln1926.seq - Plant sequence entries (including fungi and algae), part 1926.
3301. gbpln1927.seq - Plant sequence entries (including fungi and algae), part 1927.
3302. gbpln1928.seq - Plant sequence entries (including fungi and algae), part 1928.
3303. gbpln1929.seq - Plant sequence entries (including fungi and algae), part 1929.
3304. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
3305. gbpln1930.seq - Plant sequence entries (including fungi and algae), part 1930.
3306. gbpln1931.seq - Plant sequence entries (including fungi and algae), part 1931.
3307. gbpln1932.seq - Plant sequence entries (including fungi and algae), part 1932.
3308. gbpln1933.seq - Plant sequence entries (including fungi and algae), part 1933.
3309. gbpln1934.seq - Plant sequence entries (including fungi and algae), part 1934.
3310. gbpln1935.seq - Plant sequence entries (including fungi and algae), part 1935.
3311. gbpln1936.seq - Plant sequence entries (including fungi and algae), part 1936.
3312. gbpln1937.seq - Plant sequence entries (including fungi and algae), part 1937.
3313. gbpln1938.seq - Plant sequence entries (including fungi and algae), part 1938.
3314. gbpln1939.seq - Plant sequence entries (including fungi and algae), part 1939.
3315. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
3316. gbpln1940.seq - Plant sequence entries (including fungi and algae), part 1940.
3317. gbpln1941.seq - Plant sequence entries (including fungi and algae), part 1941.
3318. gbpln1942.seq - Plant sequence entries (including fungi and algae), part 1942.
3319. gbpln1943.seq - Plant sequence entries (including fungi and algae), part 1943.
3320. gbpln1944.seq - Plant sequence entries (including fungi and algae), part 1944.
3321. gbpln1945.seq - Plant sequence entries (including fungi and algae), part 1945.
3322. gbpln1946.seq - Plant sequence entries (including fungi and algae), part 1946.
3323. gbpln1947.seq - Plant sequence entries (including fungi and algae), part 1947.
3324. gbpln1948.seq - Plant sequence entries (including fungi and algae), part 1948.
3325. gbpln1949.seq - Plant sequence entries (including fungi and algae), part 1949.
3326. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
3327. gbpln1950.seq - Plant sequence entries (including fungi and algae), part 1950.
3328. gbpln1951.seq - Plant sequence entries (including fungi and algae), part 1951.
3329. gbpln1952.seq - Plant sequence entries (including fungi and algae), part 1952.
3330. gbpln1953.seq - Plant sequence entries (including fungi and algae), part 1953.
3331. gbpln1954.seq - Plant sequence entries (including fungi and algae), part 1954.
3332. gbpln1955.seq - Plant sequence entries (including fungi and algae), part 1955.
3333. gbpln1956.seq - Plant sequence entries (including fungi and algae), part 1956.
3334. gbpln1957.seq - Plant sequence entries (including fungi and algae), part 1957.
3335. gbpln1958.seq - Plant sequence entries (including fungi and algae), part 1958.
3336. gbpln1959.seq - Plant sequence entries (including fungi and algae), part 1959.
3337. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
3338. gbpln1960.seq - Plant sequence entries (including fungi and algae), part 1960.
3339. gbpln1961.seq - Plant sequence entries (including fungi and algae), part 1961.
3340. gbpln1962.seq - Plant sequence entries (including fungi and algae), part 1962.
3341. gbpln1963.seq - Plant sequence entries (including fungi and algae), part 1963.
3342. gbpln1964.seq - Plant sequence entries (including fungi and algae), part 1964.
3343. gbpln1965.seq - Plant sequence entries (including fungi and algae), part 1965.
3344. gbpln1966.seq - Plant sequence entries (including fungi and algae), part 1966.
3345. gbpln1967.seq - Plant sequence entries (including fungi and algae), part 1967.
3346. gbpln1968.seq - Plant sequence entries (including fungi and algae), part 1968.
3347. gbpln1969.seq - Plant sequence entries (including fungi and algae), part 1969.
3348. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
3349. gbpln1970.seq - Plant sequence entries (including fungi and algae), part 1970.
3350. gbpln1971.seq - Plant sequence entries (including fungi and algae), part 1971.
3351. gbpln1972.seq - Plant sequence entries (including fungi and algae), part 1972.
3352. gbpln1973.seq - Plant sequence entries (including fungi and algae), part 1973.
3353. gbpln1974.seq - Plant sequence entries (including fungi and algae), part 1974.
3354. gbpln1975.seq - Plant sequence entries (including fungi and algae), part 1975.
3355. gbpln1976.seq - Plant sequence entries (including fungi and algae), part 1976.
3356. gbpln1977.seq - Plant sequence entries (including fungi and algae), part 1977.
3357. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
3358. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
3359. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
3360. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
3361. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
3362. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
3363. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
3364. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
3365. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
3366. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
3367. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
3368. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
3369. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
3370. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
3371. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
3372. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
3373. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
3374. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
3375. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
3376. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
3377. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
3378. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
3379. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
3380. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
3381. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
3382. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
3383. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
3384. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
3385. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
3386. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
3387. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
3388. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
3389. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
3390. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
3391. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
3392. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
3393. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
3394. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
3395. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
3396. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
3397. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
3398. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
3399. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
3400. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
3401. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
3402. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
3403. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
3404. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
3405. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
3406. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
3407. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
3408. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
3409. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
3410. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
3411. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
3412. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
3413. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
3414. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
3415. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
3416. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
3417. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
3418. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
3419. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
3420. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
3421. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
3422. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
3423. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
3424. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
3425. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
3426. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
3427. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
3428. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
3429. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
3430. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
3431. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
3432. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
3433. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
3434. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
3435. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
3436. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
3437. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
3438. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
3439. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
3440. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
3441. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
3442. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
3443. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
3444. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
3445. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
3446. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
3447. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
3448. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
3449. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
3450. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
3451. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
3452. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
3453. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
3454. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
3455. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
3456. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
3457. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
3458. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
3459. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
3460. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
3461. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
3462. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
3463. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
3464. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
3465. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
3466. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
3467. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
3468. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
3469. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
3470. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
3471. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
3472. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
3473. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
3474. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
3475. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
3476. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
3477. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
3478. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
3479. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
3480. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
3481. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
3482. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
3483. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
3484. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
3485. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
3486. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
3487. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
3488. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
3489. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
3490. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
3491. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
3492. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
3493. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
3494. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
3495. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
3496. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
3497. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
3498. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
3499. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
3500. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
3501. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
3502. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
3503. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
3504. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
3505. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
3506. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
3507. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
3508. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
3509. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
3510. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
3511. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
3512. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
3513. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
3514. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
3515. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
3516. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
3517. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
3518. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
3519. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
3520. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
3521. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
3522. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
3523. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
3524. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
3525. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
3526. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
3527. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
3528. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
3529. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
3530. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
3531. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
3532. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
3533. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
3534. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
3535. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
3536. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
3537. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
3538. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
3539. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
3540. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
3541. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
3542. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
3543. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
3544. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
3545. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
3546. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
3547. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
3548. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
3549. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
3550. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
3551. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
3552. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
3553. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
3554. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
3555. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
3556. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
3557. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
3558. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
3559. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
3560. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
3561. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
3562. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
3563. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
3564. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
3565. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
3566. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
3567. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
3568. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
3569. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
3570. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
3571. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
3572. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
3573. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
3574. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
3575. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
3576. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
3577. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
3578. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
3579. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
3580. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
3581. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
3582. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
3583. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
3584. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
3585. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
3586. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
3587. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
3588. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
3589. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
3590. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
3591. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
3592. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
3593. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
3594. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
3595. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
3596. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
3597. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
3598. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
3599. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
3600. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
3601. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
3602. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
3603. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
3604. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
3605. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
3606. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
3607. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
3608. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
3609. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
3610. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
3611. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
3612. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
3613. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
3614. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
3615. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
3616. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
3617. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
3618. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
3619. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
3620. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
3621. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
3622. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
3623. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
3624. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
3625. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
3626. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
3627. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
3628. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
3629. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
3630. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
3631. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
3632. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
3633. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
3634. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
3635. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
3636. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
3637. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
3638. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
3639. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
3640. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
3641. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
3642. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
3643. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
3644. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
3645. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
3646. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
3647. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
3648. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
3649. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
3650. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
3651. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
3652. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
3653. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
3654. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
3655. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
3656. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
3657. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
3658. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
3659. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
3660. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
3661. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
3662. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
3663. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
3664. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
3665. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
3666. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
3667. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
3668. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
3669. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
3670. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
3671. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
3672. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
3673. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
3674. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
3675. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
3676. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
3677. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
3678. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
3679. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
3680. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
3681. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
3682. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
3683. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
3684. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
3685. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
3686. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
3687. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
3688. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
3689. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
3690. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
3691. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
3692. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
3693. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
3694. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
3695. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
3696. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
3697. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
3698. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
3699. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
3700. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
3701. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
3702. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
3703. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
3704. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
3705. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
3706. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
3707. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
3708. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
3709. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
3710. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
3711. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
3712. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
3713. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
3714. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
3715. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
3716. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
3717. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
3718. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
3719. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
3720. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
3721. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
3722. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
3723. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
3724. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
3725. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
3726. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
3727. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
3728. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
3729. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
3730. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
3731. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
3732. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
3733. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
3734. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
3735. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
3736. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
3737. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
3738. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
3739. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
3740. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
3741. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
3742. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
3743. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
3744. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
3745. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
3746. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
3747. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
3748. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
3749. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
3750. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
3751. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
3752. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
3753. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
3754. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
3755. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
3756. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
3757. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
3758. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
3759. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
3760. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
3761. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
3762. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
3763. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
3764. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
3765. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
3766. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
3767. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
3768. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
3769. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
3770. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
3771. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
3772. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
3773. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
3774. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
3775. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
3776. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
3777. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
3778. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
3779. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
3780. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
3781. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
3782. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
3783. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
3784. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
3785. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
3786. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
3787. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
3788. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
3789. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
3790. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
3791. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
3792. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
3793. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
3794. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
3795. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
3796. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
3797. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
3798. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
3799. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
3800. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
3801. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
3802. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
3803. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
3804. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
3805. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
3806. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
3807. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
3808. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
3809. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
3810. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
3811. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
3812. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
3813. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
3814. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
3815. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
3816. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
3817. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
3818. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
3819. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
3820. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
3821. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
3822. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
3823. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
3824. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
3825. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
3826. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
3827. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
3828. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
3829. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
3830. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
3831. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
3832. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
3833. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
3834. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
3835. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
3836. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
3837. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
3838. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
3839. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
3840. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
3841. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
3842. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
3843. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
3844. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
3845. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
3846. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
3847. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
3848. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
3849. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
3850. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
3851. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
3852. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
3853. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
3854. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
3855. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
3856. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
3857. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
3858. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
3859. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
3860. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
3861. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
3862. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
3863. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
3864. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
3865. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
3866. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
3867. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
3868. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
3869. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
3870. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
3871. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
3872. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
3873. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
3874. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
3875. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
3876. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
3877. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
3878. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
3879. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
3880. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
3881. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
3882. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
3883. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
3884. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
3885. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
3886. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
3887. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
3888. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
3889. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
3890. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
3891. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
3892. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
3893. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
3894. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
3895. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
3896. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
3897. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
3898. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
3899. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
3900. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
3901. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
3902. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
3903. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
3904. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
3905. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
3906. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
3907. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
3908. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
3909. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
3910. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
3911. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
3912. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
3913. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
3914. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
3915. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
3916. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
3917. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
3918. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
3919. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
3920. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
3921. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
3922. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
3923. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
3924. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
3925. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
3926. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
3927. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
3928. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
3929. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
3930. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
3931. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
3932. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
3933. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
3934. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
3935. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
3936. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
3937. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
3938. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
3939. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
3940. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
3941. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
3942. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724.
3943. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725.
3944. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726.
3945. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727.
3946. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728.
3947. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729.
3948. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
3949. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730.
3950. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731.
3951. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732.
3952. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733.
3953. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734.
3954. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735.
3955. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736.
3956. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737.
3957. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738.
3958. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739.
3959. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
3960. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740.
3961. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741.
3962. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742.
3963. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743.
3964. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744.
3965. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745.
3966. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746.
3967. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747.
3968. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748.
3969. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749.
3970. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
3971. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750.
3972. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751.
3973. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752.
3974. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753.
3975. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754.
3976. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755.
3977. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756.
3978. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757.
3979. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758.
3980. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759.
3981. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
3982. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760.
3983. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761.
3984. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762.
3985. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763.
3986. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764.
3987. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765.
3988. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766.
3989. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767.
3990. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768.
3991. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769.
3992. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
3993. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770.
3994. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771.
3995. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772.
3996. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773.
3997. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774.
3998. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775.
3999. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776.
4000. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777.
4001. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778.
4002. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779.
4003. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
4004. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780.
4005. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781.
4006. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782.
4007. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783.
4008. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784.
4009. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785.
4010. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786.
4011. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787.
4012. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788.
4013. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789.
4014. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
4015. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790.
4016. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791.
4017. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792.
4018. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793.
4019. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794.
4020. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795.
4021. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796.
4022. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797.
4023. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798.
4024. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799.
4025. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
4026. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
4027. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800.
4028. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801.
4029. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802.
4030. gbpln803.seq - Plant sequence entries (including fungi and algae), part 803.
4031. gbpln804.seq - Plant sequence entries (including fungi and algae), part 804.
4032. gbpln805.seq - Plant sequence entries (including fungi and algae), part 805.
4033. gbpln806.seq - Plant sequence entries (including fungi and algae), part 806.
4034. gbpln807.seq - Plant sequence entries (including fungi and algae), part 807.
4035. gbpln808.seq - Plant sequence entries (including fungi and algae), part 808.
4036. gbpln809.seq - Plant sequence entries (including fungi and algae), part 809.
4037. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
4038. gbpln810.seq - Plant sequence entries (including fungi and algae), part 810.
4039. gbpln811.seq - Plant sequence entries (including fungi and algae), part 811.
4040. gbpln812.seq - Plant sequence entries (including fungi and algae), part 812.
4041. gbpln813.seq - Plant sequence entries (including fungi and algae), part 813.
4042. gbpln814.seq - Plant sequence entries (including fungi and algae), part 814.
4043. gbpln815.seq - Plant sequence entries (including fungi and algae), part 815.
4044. gbpln816.seq - Plant sequence entries (including fungi and algae), part 816.
4045. gbpln817.seq - Plant sequence entries (including fungi and algae), part 817.
4046. gbpln818.seq - Plant sequence entries (including fungi and algae), part 818.
4047. gbpln819.seq - Plant sequence entries (including fungi and algae), part 819.
4048. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
4049. gbpln820.seq - Plant sequence entries (including fungi and algae), part 820.
4050. gbpln821.seq - Plant sequence entries (including fungi and algae), part 821.
4051. gbpln822.seq - Plant sequence entries (including fungi and algae), part 822.
4052. gbpln823.seq - Plant sequence entries (including fungi and algae), part 823.
4053. gbpln824.seq - Plant sequence entries (including fungi and algae), part 824.
4054. gbpln825.seq - Plant sequence entries (including fungi and algae), part 825.
4055. gbpln826.seq - Plant sequence entries (including fungi and algae), part 826.
4056. gbpln827.seq - Plant sequence entries (including fungi and algae), part 827.
4057. gbpln828.seq - Plant sequence entries (including fungi and algae), part 828.
4058. gbpln829.seq - Plant sequence entries (including fungi and algae), part 829.
4059. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
4060. gbpln830.seq - Plant sequence entries (including fungi and algae), part 830.
4061. gbpln831.seq - Plant sequence entries (including fungi and algae), part 831.
4062. gbpln832.seq - Plant sequence entries (including fungi and algae), part 832.
4063. gbpln833.seq - Plant sequence entries (including fungi and algae), part 833.
4064. gbpln834.seq - Plant sequence entries (including fungi and algae), part 834.
4065. gbpln835.seq - Plant sequence entries (including fungi and algae), part 835.
4066. gbpln836.seq - Plant sequence entries (including fungi and algae), part 836.
4067. gbpln837.seq - Plant sequence entries (including fungi and algae), part 837.
4068. gbpln838.seq - Plant sequence entries (including fungi and algae), part 838.
4069. gbpln839.seq - Plant sequence entries (including fungi and algae), part 839.
4070. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
4071. gbpln840.seq - Plant sequence entries (including fungi and algae), part 840.
4072. gbpln841.seq - Plant sequence entries (including fungi and algae), part 841.
4073. gbpln842.seq - Plant sequence entries (including fungi and algae), part 842.
4074. gbpln843.seq - Plant sequence entries (including fungi and algae), part 843.
4075. gbpln844.seq - Plant sequence entries (including fungi and algae), part 844.
4076. gbpln845.seq - Plant sequence entries (including fungi and algae), part 845.
4077. gbpln846.seq - Plant sequence entries (including fungi and algae), part 846.
4078. gbpln847.seq - Plant sequence entries (including fungi and algae), part 847.
4079. gbpln848.seq - Plant sequence entries (including fungi and algae), part 848.
4080. gbpln849.seq - Plant sequence entries (including fungi and algae), part 849.
4081. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
4082. gbpln850.seq - Plant sequence entries (including fungi and algae), part 850.
4083. gbpln851.seq - Plant sequence entries (including fungi and algae), part 851.
4084. gbpln852.seq - Plant sequence entries (including fungi and algae), part 852.
4085. gbpln853.seq - Plant sequence entries (including fungi and algae), part 853.
4086. gbpln854.seq - Plant sequence entries (including fungi and algae), part 854.
4087. gbpln855.seq - Plant sequence entries (including fungi and algae), part 855.
4088. gbpln856.seq - Plant sequence entries (including fungi and algae), part 856.
4089. gbpln857.seq - Plant sequence entries (including fungi and algae), part 857.
4090. gbpln858.seq - Plant sequence entries (including fungi and algae), part 858.
4091. gbpln859.seq - Plant sequence entries (including fungi and algae), part 859.
4092. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
4093. gbpln860.seq - Plant sequence entries (including fungi and algae), part 860.
4094. gbpln861.seq - Plant sequence entries (including fungi and algae), part 861.
4095. gbpln862.seq - Plant sequence entries (including fungi and algae), part 862.
4096. gbpln863.seq - Plant sequence entries (including fungi and algae), part 863.
4097. gbpln864.seq - Plant sequence entries (including fungi and algae), part 864.
4098. gbpln865.seq - Plant sequence entries (including fungi and algae), part 865.
4099. gbpln866.seq - Plant sequence entries (including fungi and algae), part 866.
4100. gbpln867.seq - Plant sequence entries (including fungi and algae), part 867.
4101. gbpln868.seq - Plant sequence entries (including fungi and algae), part 868.
4102. gbpln869.seq - Plant sequence entries (including fungi and algae), part 869.
4103. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
4104. gbpln870.seq - Plant sequence entries (including fungi and algae), part 870.
4105. gbpln871.seq - Plant sequence entries (including fungi and algae), part 871.
4106. gbpln872.seq - Plant sequence entries (including fungi and algae), part 872.
4107. gbpln873.seq - Plant sequence entries (including fungi and algae), part 873.
4108. gbpln874.seq - Plant sequence entries (including fungi and algae), part 874.
4109. gbpln875.seq - Plant sequence entries (including fungi and algae), part 875.
4110. gbpln876.seq - Plant sequence entries (including fungi and algae), part 876.
4111. gbpln877.seq - Plant sequence entries (including fungi and algae), part 877.
4112. gbpln878.seq - Plant sequence entries (including fungi and algae), part 878.
4113. gbpln879.seq - Plant sequence entries (including fungi and algae), part 879.
4114. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
4115. gbpln880.seq - Plant sequence entries (including fungi and algae), part 880.
4116. gbpln881.seq - Plant sequence entries (including fungi and algae), part 881.
4117. gbpln882.seq - Plant sequence entries (including fungi and algae), part 882.
4118. gbpln883.seq - Plant sequence entries (including fungi and algae), part 883.
4119. gbpln884.seq - Plant sequence entries (including fungi and algae), part 884.
4120. gbpln885.seq - Plant sequence entries (including fungi and algae), part 885.
4121. gbpln886.seq - Plant sequence entries (including fungi and algae), part 886.
4122. gbpln887.seq - Plant sequence entries (including fungi and algae), part 887.
4123. gbpln888.seq - Plant sequence entries (including fungi and algae), part 888.
4124. gbpln889.seq - Plant sequence entries (including fungi and algae), part 889.
4125. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
4126. gbpln890.seq - Plant sequence entries (including fungi and algae), part 890.
4127. gbpln891.seq - Plant sequence entries (including fungi and algae), part 891.
4128. gbpln892.seq - Plant sequence entries (including fungi and algae), part 892.
4129. gbpln893.seq - Plant sequence entries (including fungi and algae), part 893.
4130. gbpln894.seq - Plant sequence entries (including fungi and algae), part 894.
4131. gbpln895.seq - Plant sequence entries (including fungi and algae), part 895.
4132. gbpln896.seq - Plant sequence entries (including fungi and algae), part 896.
4133. gbpln897.seq - Plant sequence entries (including fungi and algae), part 897.
4134. gbpln898.seq - Plant sequence entries (including fungi and algae), part 898.
4135. gbpln899.seq - Plant sequence entries (including fungi and algae), part 899.
4136. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
4137. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
4138. gbpln900.seq - Plant sequence entries (including fungi and algae), part 900.
4139. gbpln901.seq - Plant sequence entries (including fungi and algae), part 901.
4140. gbpln902.seq - Plant sequence entries (including fungi and algae), part 902.
4141. gbpln903.seq - Plant sequence entries (including fungi and algae), part 903.
4142. gbpln904.seq - Plant sequence entries (including fungi and algae), part 904.
4143. gbpln905.seq - Plant sequence entries (including fungi and algae), part 905.
4144. gbpln906.seq - Plant sequence entries (including fungi and algae), part 906.
4145. gbpln907.seq - Plant sequence entries (including fungi and algae), part 907.
4146. gbpln908.seq - Plant sequence entries (including fungi and algae), part 908.
4147. gbpln909.seq - Plant sequence entries (including fungi and algae), part 909.
4148. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
4149. gbpln910.seq - Plant sequence entries (including fungi and algae), part 910.
4150. gbpln911.seq - Plant sequence entries (including fungi and algae), part 911.
4151. gbpln912.seq - Plant sequence entries (including fungi and algae), part 912.
4152. gbpln913.seq - Plant sequence entries (including fungi and algae), part 913.
4153. gbpln914.seq - Plant sequence entries (including fungi and algae), part 914.
4154. gbpln915.seq - Plant sequence entries (including fungi and algae), part 915.
4155. gbpln916.seq - Plant sequence entries (including fungi and algae), part 916.
4156. gbpln917.seq - Plant sequence entries (including fungi and algae), part 917.
4157. gbpln918.seq - Plant sequence entries (including fungi and algae), part 918.
4158. gbpln919.seq - Plant sequence entries (including fungi and algae), part 919.
4159. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
4160. gbpln920.seq - Plant sequence entries (including fungi and algae), part 920.
4161. gbpln921.seq - Plant sequence entries (including fungi and algae), part 921.
4162. gbpln922.seq - Plant sequence entries (including fungi and algae), part 922.
4163. gbpln923.seq - Plant sequence entries (including fungi and algae), part 923.
4164. gbpln924.seq - Plant sequence entries (including fungi and algae), part 924.
4165. gbpln925.seq - Plant sequence entries (including fungi and algae), part 925.
4166. gbpln926.seq - Plant sequence entries (including fungi and algae), part 926.
4167. gbpln927.seq - Plant sequence entries (including fungi and algae), part 927.
4168. gbpln928.seq - Plant sequence entries (including fungi and algae), part 928.
4169. gbpln929.seq - Plant sequence entries (including fungi and algae), part 929.
4170. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
4171. gbpln930.seq - Plant sequence entries (including fungi and algae), part 930.
4172. gbpln931.seq - Plant sequence entries (including fungi and algae), part 931.
4173. gbpln932.seq - Plant sequence entries (including fungi and algae), part 932.
4174. gbpln933.seq - Plant sequence entries (including fungi and algae), part 933.
4175. gbpln934.seq - Plant sequence entries (including fungi and algae), part 934.
4176. gbpln935.seq - Plant sequence entries (including fungi and algae), part 935.
4177. gbpln936.seq - Plant sequence entries (including fungi and algae), part 936.
4178. gbpln937.seq - Plant sequence entries (including fungi and algae), part 937.
4179. gbpln938.seq - Plant sequence entries (including fungi and algae), part 938.
4180. gbpln939.seq - Plant sequence entries (including fungi and algae), part 939.
4181. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
4182. gbpln940.seq - Plant sequence entries (including fungi and algae), part 940.
4183. gbpln941.seq - Plant sequence entries (including fungi and algae), part 941.
4184. gbpln942.seq - Plant sequence entries (including fungi and algae), part 942.
4185. gbpln943.seq - Plant sequence entries (including fungi and algae), part 943.
4186. gbpln944.seq - Plant sequence entries (including fungi and algae), part 944.
4187. gbpln945.seq - Plant sequence entries (including fungi and algae), part 945.
4188. gbpln946.seq - Plant sequence entries (including fungi and algae), part 946.
4189. gbpln947.seq - Plant sequence entries (including fungi and algae), part 947.
4190. gbpln948.seq - Plant sequence entries (including fungi and algae), part 948.
4191. gbpln949.seq - Plant sequence entries (including fungi and algae), part 949.
4192. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
4193. gbpln950.seq - Plant sequence entries (including fungi and algae), part 950.
4194. gbpln951.seq - Plant sequence entries (including fungi and algae), part 951.
4195. gbpln952.seq - Plant sequence entries (including fungi and algae), part 952.
4196. gbpln953.seq - Plant sequence entries (including fungi and algae), part 953.
4197. gbpln954.seq - Plant sequence entries (including fungi and algae), part 954.
4198. gbpln955.seq - Plant sequence entries (including fungi and algae), part 955.
4199. gbpln956.seq - Plant sequence entries (including fungi and algae), part 956.
4200. gbpln957.seq - Plant sequence entries (including fungi and algae), part 957.
4201. gbpln958.seq - Plant sequence entries (including fungi and algae), part 958.
4202. gbpln959.seq - Plant sequence entries (including fungi and algae), part 959.
4203. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
4204. gbpln960.seq - Plant sequence entries (including fungi and algae), part 960.
4205. gbpln961.seq - Plant sequence entries (including fungi and algae), part 961.
4206. gbpln962.seq - Plant sequence entries (including fungi and algae), part 962.
4207. gbpln963.seq - Plant sequence entries (including fungi and algae), part 963.
4208. gbpln964.seq - Plant sequence entries (including fungi and algae), part 964.
4209. gbpln965.seq - Plant sequence entries (including fungi and algae), part 965.
4210. gbpln966.seq - Plant sequence entries (including fungi and algae), part 966.
4211. gbpln967.seq - Plant sequence entries (including fungi and algae), part 967.
4212. gbpln968.seq - Plant sequence entries (including fungi and algae), part 968.
4213. gbpln969.seq - Plant sequence entries (including fungi and algae), part 969.
4214. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
4215. gbpln970.seq - Plant sequence entries (including fungi and algae), part 970.
4216. gbpln971.seq - Plant sequence entries (including fungi and algae), part 971.
4217. gbpln972.seq - Plant sequence entries (including fungi and algae), part 972.
4218. gbpln973.seq - Plant sequence entries (including fungi and algae), part 973.
4219. gbpln974.seq - Plant sequence entries (including fungi and algae), part 974.
4220. gbpln975.seq - Plant sequence entries (including fungi and algae), part 975.
4221. gbpln976.seq - Plant sequence entries (including fungi and algae), part 976.
4222. gbpln977.seq - Plant sequence entries (including fungi and algae), part 977.
4223. gbpln978.seq - Plant sequence entries (including fungi and algae), part 978.
4224. gbpln979.seq - Plant sequence entries (including fungi and algae), part 979.
4225. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
4226. gbpln980.seq - Plant sequence entries (including fungi and algae), part 980.
4227. gbpln981.seq - Plant sequence entries (including fungi and algae), part 981.
4228. gbpln982.seq - Plant sequence entries (including fungi and algae), part 982.
4229. gbpln983.seq - Plant sequence entries (including fungi and algae), part 983.
4230. gbpln984.seq - Plant sequence entries (including fungi and algae), part 984.
4231. gbpln985.seq - Plant sequence entries (including fungi and algae), part 985.
4232. gbpln986.seq - Plant sequence entries (including fungi and algae), part 986.
4233. gbpln987.seq - Plant sequence entries (including fungi and algae), part 987.
4234. gbpln988.seq - Plant sequence entries (including fungi and algae), part 988.
4235. gbpln989.seq - Plant sequence entries (including fungi and algae), part 989.
4236. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
4237. gbpln990.seq - Plant sequence entries (including fungi and algae), part 990.
4238. gbpln991.seq - Plant sequence entries (including fungi and algae), part 991.
4239. gbpln992.seq - Plant sequence entries (including fungi and algae), part 992.
4240. gbpln993.seq - Plant sequence entries (including fungi and algae), part 993.
4241. gbpln994.seq - Plant sequence entries (including fungi and algae), part 994.
4242. gbpln995.seq - Plant sequence entries (including fungi and algae), part 995.
4243. gbpln996.seq - Plant sequence entries (including fungi and algae), part 996.
4244. gbpln997.seq - Plant sequence entries (including fungi and algae), part 997.
4245. gbpln998.seq - Plant sequence entries (including fungi and algae), part 998.
4246. gbpln999.seq - Plant sequence entries (including fungi and algae), part 999.
4247. gbpri1.seq - Primate sequence entries, part 1.
4248. gbpri10.seq - Primate sequence entries, part 10.
4249. gbpri100.seq - Primate sequence entries, part 100.
4250. gbpri101.seq - Primate sequence entries, part 101.
4251. gbpri102.seq - Primate sequence entries, part 102.
4252. gbpri103.seq - Primate sequence entries, part 103.
4253. gbpri104.seq - Primate sequence entries, part 104.
4254. gbpri105.seq - Primate sequence entries, part 105.
4255. gbpri106.seq - Primate sequence entries, part 106.
4256. gbpri107.seq - Primate sequence entries, part 107.
4257. gbpri108.seq - Primate sequence entries, part 108.
4258. gbpri109.seq - Primate sequence entries, part 109.
4259. gbpri11.seq - Primate sequence entries, part 11.
4260. gbpri110.seq - Primate sequence entries, part 110.
4261. gbpri111.seq - Primate sequence entries, part 111.
4262. gbpri112.seq - Primate sequence entries, part 112.
4263. gbpri113.seq - Primate sequence entries, part 113.
4264. gbpri114.seq - Primate sequence entries, part 114.
4265. gbpri115.seq - Primate sequence entries, part 115.
4266. gbpri116.seq - Primate sequence entries, part 116.
4267. gbpri117.seq - Primate sequence entries, part 117.
4268. gbpri118.seq - Primate sequence entries, part 118.
4269. gbpri119.seq - Primate sequence entries, part 119.
4270. gbpri12.seq - Primate sequence entries, part 12.
4271. gbpri120.seq - Primate sequence entries, part 120.
4272. gbpri121.seq - Primate sequence entries, part 121.
4273. gbpri122.seq - Primate sequence entries, part 122.
4274. gbpri123.seq - Primate sequence entries, part 123.
4275. gbpri124.seq - Primate sequence entries, part 124.
4276. gbpri125.seq - Primate sequence entries, part 125.
4277. gbpri126.seq - Primate sequence entries, part 126.
4278. gbpri127.seq - Primate sequence entries, part 127.
4279. gbpri128.seq - Primate sequence entries, part 128.
4280. gbpri129.seq - Primate sequence entries, part 129.
4281. gbpri13.seq - Primate sequence entries, part 13.
4282. gbpri130.seq - Primate sequence entries, part 130.
4283. gbpri131.seq - Primate sequence entries, part 131.
4284. gbpri132.seq - Primate sequence entries, part 132.
4285. gbpri133.seq - Primate sequence entries, part 133.
4286. gbpri134.seq - Primate sequence entries, part 134.
4287. gbpri135.seq - Primate sequence entries, part 135.
4288. gbpri136.seq - Primate sequence entries, part 136.
4289. gbpri137.seq - Primate sequence entries, part 137.
4290. gbpri138.seq - Primate sequence entries, part 138.
4291. gbpri139.seq - Primate sequence entries, part 139.
4292. gbpri14.seq - Primate sequence entries, part 14.
4293. gbpri140.seq - Primate sequence entries, part 140.
4294. gbpri141.seq - Primate sequence entries, part 141.
4295. gbpri142.seq - Primate sequence entries, part 142.
4296. gbpri143.seq - Primate sequence entries, part 143.
4297. gbpri144.seq - Primate sequence entries, part 144.
4298. gbpri145.seq - Primate sequence entries, part 145.
4299. gbpri146.seq - Primate sequence entries, part 146.
4300. gbpri147.seq - Primate sequence entries, part 147.
4301. gbpri148.seq - Primate sequence entries, part 148.
4302. gbpri149.seq - Primate sequence entries, part 149.
4303. gbpri15.seq - Primate sequence entries, part 15.
4304. gbpri150.seq - Primate sequence entries, part 150.
4305. gbpri151.seq - Primate sequence entries, part 151.
4306. gbpri152.seq - Primate sequence entries, part 152.
4307. gbpri153.seq - Primate sequence entries, part 153.
4308. gbpri154.seq - Primate sequence entries, part 154.
4309. gbpri155.seq - Primate sequence entries, part 155.
4310. gbpri156.seq - Primate sequence entries, part 156.
4311. gbpri157.seq - Primate sequence entries, part 157.
4312. gbpri158.seq - Primate sequence entries, part 158.
4313. gbpri159.seq - Primate sequence entries, part 159.
4314. gbpri16.seq - Primate sequence entries, part 16.
4315. gbpri160.seq - Primate sequence entries, part 160.
4316. gbpri161.seq - Primate sequence entries, part 161.
4317. gbpri162.seq - Primate sequence entries, part 162.
4318. gbpri163.seq - Primate sequence entries, part 163.
4319. gbpri164.seq - Primate sequence entries, part 164.
4320. gbpri165.seq - Primate sequence entries, part 165.
4321. gbpri166.seq - Primate sequence entries, part 166.
4322. gbpri167.seq - Primate sequence entries, part 167.
4323. gbpri168.seq - Primate sequence entries, part 168.
4324. gbpri169.seq - Primate sequence entries, part 169.
4325. gbpri17.seq - Primate sequence entries, part 17.
4326. gbpri170.seq - Primate sequence entries, part 170.
4327. gbpri171.seq - Primate sequence entries, part 171.
4328. gbpri172.seq - Primate sequence entries, part 172.
4329. gbpri173.seq - Primate sequence entries, part 173.
4330. gbpri174.seq - Primate sequence entries, part 174.
4331. gbpri175.seq - Primate sequence entries, part 175.
4332. gbpri176.seq - Primate sequence entries, part 176.
4333. gbpri177.seq - Primate sequence entries, part 177.
4334. gbpri178.seq - Primate sequence entries, part 178.
4335. gbpri179.seq - Primate sequence entries, part 179.
4336. gbpri18.seq - Primate sequence entries, part 18.
4337. gbpri180.seq - Primate sequence entries, part 180.
4338. gbpri181.seq - Primate sequence entries, part 181.
4339. gbpri182.seq - Primate sequence entries, part 182.
4340. gbpri183.seq - Primate sequence entries, part 183.
4341. gbpri184.seq - Primate sequence entries, part 184.
4342. gbpri185.seq - Primate sequence entries, part 185.
4343. gbpri186.seq - Primate sequence entries, part 186.
4344. gbpri187.seq - Primate sequence entries, part 187.
4345. gbpri188.seq - Primate sequence entries, part 188.
4346. gbpri189.seq - Primate sequence entries, part 189.
4347. gbpri19.seq - Primate sequence entries, part 19.
4348. gbpri190.seq - Primate sequence entries, part 190.
4349. gbpri191.seq - Primate sequence entries, part 191.
4350. gbpri192.seq - Primate sequence entries, part 192.
4351. gbpri193.seq - Primate sequence entries, part 193.
4352. gbpri194.seq - Primate sequence entries, part 194.
4353. gbpri195.seq - Primate sequence entries, part 195.
4354. gbpri196.seq - Primate sequence entries, part 196.
4355. gbpri197.seq - Primate sequence entries, part 197.
4356. gbpri198.seq - Primate sequence entries, part 198.
4357. gbpri199.seq - Primate sequence entries, part 199.
4358. gbpri2.seq - Primate sequence entries, part 2.
4359. gbpri20.seq - Primate sequence entries, part 20.
4360. gbpri200.seq - Primate sequence entries, part 200.
4361. gbpri201.seq - Primate sequence entries, part 201.
4362. gbpri202.seq - Primate sequence entries, part 202.
4363. gbpri203.seq - Primate sequence entries, part 203.
4364. gbpri204.seq - Primate sequence entries, part 204.
4365. gbpri205.seq - Primate sequence entries, part 205.
4366. gbpri206.seq - Primate sequence entries, part 206.
4367. gbpri207.seq - Primate sequence entries, part 207.
4368. gbpri208.seq - Primate sequence entries, part 208.
4369. gbpri209.seq - Primate sequence entries, part 209.
4370. gbpri21.seq - Primate sequence entries, part 21.
4371. gbpri210.seq - Primate sequence entries, part 210.
4372. gbpri211.seq - Primate sequence entries, part 211.
4373. gbpri212.seq - Primate sequence entries, part 212.
4374. gbpri213.seq - Primate sequence entries, part 213.
4375. gbpri214.seq - Primate sequence entries, part 214.
4376. gbpri215.seq - Primate sequence entries, part 215.
4377. gbpri216.seq - Primate sequence entries, part 216.
4378. gbpri217.seq - Primate sequence entries, part 217.
4379. gbpri218.seq - Primate sequence entries, part 218.
4380. gbpri219.seq - Primate sequence entries, part 219.
4381. gbpri22.seq - Primate sequence entries, part 22.
4382. gbpri220.seq - Primate sequence entries, part 220.
4383. gbpri221.seq - Primate sequence entries, part 221.
4384. gbpri222.seq - Primate sequence entries, part 222.
4385. gbpri223.seq - Primate sequence entries, part 223.
4386. gbpri224.seq - Primate sequence entries, part 224.
4387. gbpri225.seq - Primate sequence entries, part 225.
4388. gbpri226.seq - Primate sequence entries, part 226.
4389. gbpri227.seq - Primate sequence entries, part 227.
4390. gbpri228.seq - Primate sequence entries, part 228.
4391. gbpri229.seq - Primate sequence entries, part 229.
4392. gbpri23.seq - Primate sequence entries, part 23.
4393. gbpri230.seq - Primate sequence entries, part 230.
4394. gbpri231.seq - Primate sequence entries, part 231.
4395. gbpri232.seq - Primate sequence entries, part 232.
4396. gbpri233.seq - Primate sequence entries, part 233.
4397. gbpri234.seq - Primate sequence entries, part 234.
4398. gbpri235.seq - Primate sequence entries, part 235.
4399. gbpri236.seq - Primate sequence entries, part 236.
4400. gbpri237.seq - Primate sequence entries, part 237.
4401. gbpri238.seq - Primate sequence entries, part 238.
4402. gbpri239.seq - Primate sequence entries, part 239.
4403. gbpri24.seq - Primate sequence entries, part 24.
4404. gbpri240.seq - Primate sequence entries, part 240.
4405. gbpri241.seq - Primate sequence entries, part 241.
4406. gbpri242.seq - Primate sequence entries, part 242.
4407. gbpri243.seq - Primate sequence entries, part 243.
4408. gbpri244.seq - Primate sequence entries, part 244.
4409. gbpri245.seq - Primate sequence entries, part 245.
4410. gbpri246.seq - Primate sequence entries, part 246.
4411. gbpri247.seq - Primate sequence entries, part 247.
4412. gbpri248.seq - Primate sequence entries, part 248.
4413. gbpri249.seq - Primate sequence entries, part 249.
4414. gbpri25.seq - Primate sequence entries, part 25.
4415. gbpri250.seq - Primate sequence entries, part 250.
4416. gbpri251.seq - Primate sequence entries, part 251.
4417. gbpri252.seq - Primate sequence entries, part 252.
4418. gbpri253.seq - Primate sequence entries, part 253.
4419. gbpri254.seq - Primate sequence entries, part 254.
4420. gbpri255.seq - Primate sequence entries, part 255.
4421. gbpri256.seq - Primate sequence entries, part 256.
4422. gbpri257.seq - Primate sequence entries, part 257.
4423. gbpri258.seq - Primate sequence entries, part 258.
4424. gbpri259.seq - Primate sequence entries, part 259.
4425. gbpri26.seq - Primate sequence entries, part 26.
4426. gbpri260.seq - Primate sequence entries, part 260.
4427. gbpri261.seq - Primate sequence entries, part 261.
4428. gbpri262.seq - Primate sequence entries, part 262.
4429. gbpri263.seq - Primate sequence entries, part 263.
4430. gbpri264.seq - Primate sequence entries, part 264.
4431. gbpri265.seq - Primate sequence entries, part 265.
4432. gbpri266.seq - Primate sequence entries, part 266.
4433. gbpri267.seq - Primate sequence entries, part 267.
4434. gbpri268.seq - Primate sequence entries, part 268.
4435. gbpri269.seq - Primate sequence entries, part 269.
4436. gbpri27.seq - Primate sequence entries, part 27.
4437. gbpri270.seq - Primate sequence entries, part 270.
4438. gbpri271.seq - Primate sequence entries, part 271.
4439. gbpri272.seq - Primate sequence entries, part 272.
4440. gbpri273.seq - Primate sequence entries, part 273.
4441. gbpri274.seq - Primate sequence entries, part 274.
4442. gbpri275.seq - Primate sequence entries, part 275.
4443. gbpri276.seq - Primate sequence entries, part 276.
4444. gbpri277.seq - Primate sequence entries, part 277.
4445. gbpri278.seq - Primate sequence entries, part 278.
4446. gbpri279.seq - Primate sequence entries, part 279.
4447. gbpri28.seq - Primate sequence entries, part 28.
4448. gbpri280.seq - Primate sequence entries, part 280.
4449. gbpri281.seq - Primate sequence entries, part 281.
4450. gbpri282.seq - Primate sequence entries, part 282.
4451. gbpri283.seq - Primate sequence entries, part 283.
4452. gbpri284.seq - Primate sequence entries, part 284.
4453. gbpri285.seq - Primate sequence entries, part 285.
4454. gbpri286.seq - Primate sequence entries, part 286.
4455. gbpri287.seq - Primate sequence entries, part 287.
4456. gbpri288.seq - Primate sequence entries, part 288.
4457. gbpri289.seq - Primate sequence entries, part 289.
4458. gbpri29.seq - Primate sequence entries, part 29.
4459. gbpri290.seq - Primate sequence entries, part 290.
4460. gbpri291.seq - Primate sequence entries, part 291.
4461. gbpri292.seq - Primate sequence entries, part 292.
4462. gbpri293.seq - Primate sequence entries, part 293.
4463. gbpri294.seq - Primate sequence entries, part 294.
4464. gbpri295.seq - Primate sequence entries, part 295.
4465. gbpri296.seq - Primate sequence entries, part 296.
4466. gbpri297.seq - Primate sequence entries, part 297.
4467. gbpri298.seq - Primate sequence entries, part 298.
4468. gbpri299.seq - Primate sequence entries, part 299.
4469. gbpri3.seq - Primate sequence entries, part 3.
4470. gbpri30.seq - Primate sequence entries, part 30.
4471. gbpri300.seq - Primate sequence entries, part 300.
4472. gbpri301.seq - Primate sequence entries, part 301.
4473. gbpri302.seq - Primate sequence entries, part 302.
4474. gbpri303.seq - Primate sequence entries, part 303.
4475. gbpri304.seq - Primate sequence entries, part 304.
4476. gbpri305.seq - Primate sequence entries, part 305.
4477. gbpri306.seq - Primate sequence entries, part 306.
4478. gbpri307.seq - Primate sequence entries, part 307.
4479. gbpri308.seq - Primate sequence entries, part 308.
4480. gbpri309.seq - Primate sequence entries, part 309.
4481. gbpri31.seq - Primate sequence entries, part 31.
4482. gbpri310.seq - Primate sequence entries, part 310.
4483. gbpri311.seq - Primate sequence entries, part 311.
4484. gbpri312.seq - Primate sequence entries, part 312.
4485. gbpri313.seq - Primate sequence entries, part 313.
4486. gbpri314.seq - Primate sequence entries, part 314.
4487. gbpri315.seq - Primate sequence entries, part 315.
4488. gbpri316.seq - Primate sequence entries, part 316.
4489. gbpri317.seq - Primate sequence entries, part 317.
4490. gbpri318.seq - Primate sequence entries, part 318.
4491. gbpri319.seq - Primate sequence entries, part 319.
4492. gbpri32.seq - Primate sequence entries, part 32.
4493. gbpri320.seq - Primate sequence entries, part 320.
4494. gbpri321.seq - Primate sequence entries, part 321.
4495. gbpri322.seq - Primate sequence entries, part 322.
4496. gbpri323.seq - Primate sequence entries, part 323.
4497. gbpri324.seq - Primate sequence entries, part 324.
4498. gbpri325.seq - Primate sequence entries, part 325.
4499. gbpri326.seq - Primate sequence entries, part 326.
4500. gbpri327.seq - Primate sequence entries, part 327.
4501. gbpri328.seq - Primate sequence entries, part 328.
4502. gbpri329.seq - Primate sequence entries, part 329.
4503. gbpri33.seq - Primate sequence entries, part 33.
4504. gbpri330.seq - Primate sequence entries, part 330.
4505. gbpri331.seq - Primate sequence entries, part 331.
4506. gbpri332.seq - Primate sequence entries, part 332.
4507. gbpri333.seq - Primate sequence entries, part 333.
4508. gbpri334.seq - Primate sequence entries, part 334.
4509. gbpri335.seq - Primate sequence entries, part 335.
4510. gbpri336.seq - Primate sequence entries, part 336.
4511. gbpri337.seq - Primate sequence entries, part 337.
4512. gbpri338.seq - Primate sequence entries, part 338.
4513. gbpri339.seq - Primate sequence entries, part 339.
4514. gbpri34.seq - Primate sequence entries, part 34.
4515. gbpri340.seq - Primate sequence entries, part 340.
4516. gbpri341.seq - Primate sequence entries, part 341.
4517. gbpri342.seq - Primate sequence entries, part 342.
4518. gbpri343.seq - Primate sequence entries, part 343.
4519. gbpri344.seq - Primate sequence entries, part 344.
4520. gbpri345.seq - Primate sequence entries, part 345.
4521. gbpri346.seq - Primate sequence entries, part 346.
4522. gbpri347.seq - Primate sequence entries, part 347.
4523. gbpri348.seq - Primate sequence entries, part 348.
4524. gbpri349.seq - Primate sequence entries, part 349.
4525. gbpri35.seq - Primate sequence entries, part 35.
4526. gbpri350.seq - Primate sequence entries, part 350.
4527. gbpri351.seq - Primate sequence entries, part 351.
4528. gbpri352.seq - Primate sequence entries, part 352.
4529. gbpri353.seq - Primate sequence entries, part 353.
4530. gbpri354.seq - Primate sequence entries, part 354.
4531. gbpri355.seq - Primate sequence entries, part 355.
4532. gbpri356.seq - Primate sequence entries, part 356.
4533. gbpri357.seq - Primate sequence entries, part 357.
4534. gbpri358.seq - Primate sequence entries, part 358.
4535. gbpri359.seq - Primate sequence entries, part 359.
4536. gbpri36.seq - Primate sequence entries, part 36.
4537. gbpri360.seq - Primate sequence entries, part 360.
4538. gbpri361.seq - Primate sequence entries, part 361.
4539. gbpri362.seq - Primate sequence entries, part 362.
4540. gbpri363.seq - Primate sequence entries, part 363.
4541. gbpri364.seq - Primate sequence entries, part 364.
4542. gbpri365.seq - Primate sequence entries, part 365.
4543. gbpri366.seq - Primate sequence entries, part 366.
4544. gbpri367.seq - Primate sequence entries, part 367.
4545. gbpri368.seq - Primate sequence entries, part 368.
4546. gbpri369.seq - Primate sequence entries, part 369.
4547. gbpri37.seq - Primate sequence entries, part 37.
4548. gbpri370.seq - Primate sequence entries, part 370.
4549. gbpri371.seq - Primate sequence entries, part 371.
4550. gbpri372.seq - Primate sequence entries, part 372.
4551. gbpri373.seq - Primate sequence entries, part 373.
4552. gbpri374.seq - Primate sequence entries, part 374.
4553. gbpri375.seq - Primate sequence entries, part 375.
4554. gbpri376.seq - Primate sequence entries, part 376.
4555. gbpri377.seq - Primate sequence entries, part 377.
4556. gbpri378.seq - Primate sequence entries, part 378.
4557. gbpri379.seq - Primate sequence entries, part 379.
4558. gbpri38.seq - Primate sequence entries, part 38.
4559. gbpri380.seq - Primate sequence entries, part 380.
4560. gbpri381.seq - Primate sequence entries, part 381.
4561. gbpri382.seq - Primate sequence entries, part 382.
4562. gbpri383.seq - Primate sequence entries, part 383.
4563. gbpri384.seq - Primate sequence entries, part 384.
4564. gbpri385.seq - Primate sequence entries, part 385.
4565. gbpri386.seq - Primate sequence entries, part 386.
4566. gbpri387.seq - Primate sequence entries, part 387.
4567. gbpri388.seq - Primate sequence entries, part 388.
4568. gbpri389.seq - Primate sequence entries, part 389.
4569. gbpri39.seq - Primate sequence entries, part 39.
4570. gbpri390.seq - Primate sequence entries, part 390.
4571. gbpri391.seq - Primate sequence entries, part 391.
4572. gbpri392.seq - Primate sequence entries, part 392.
4573. gbpri393.seq - Primate sequence entries, part 393.
4574. gbpri394.seq - Primate sequence entries, part 394.
4575. gbpri395.seq - Primate sequence entries, part 395.
4576. gbpri396.seq - Primate sequence entries, part 396.
4577. gbpri397.seq - Primate sequence entries, part 397.
4578. gbpri398.seq - Primate sequence entries, part 398.
4579. gbpri399.seq - Primate sequence entries, part 399.
4580. gbpri4.seq - Primate sequence entries, part 4.
4581. gbpri40.seq - Primate sequence entries, part 40.
4582. gbpri400.seq - Primate sequence entries, part 400.
4583. gbpri401.seq - Primate sequence entries, part 401.
4584. gbpri402.seq - Primate sequence entries, part 402.
4585. gbpri403.seq - Primate sequence entries, part 403.
4586. gbpri404.seq - Primate sequence entries, part 404.
4587. gbpri405.seq - Primate sequence entries, part 405.
4588. gbpri406.seq - Primate sequence entries, part 406.
4589. gbpri407.seq - Primate sequence entries, part 407.
4590. gbpri408.seq - Primate sequence entries, part 408.
4591. gbpri409.seq - Primate sequence entries, part 409.
4592. gbpri41.seq - Primate sequence entries, part 41.
4593. gbpri410.seq - Primate sequence entries, part 410.
4594. gbpri411.seq - Primate sequence entries, part 411.
4595. gbpri412.seq - Primate sequence entries, part 412.
4596. gbpri413.seq - Primate sequence entries, part 413.
4597. gbpri414.seq - Primate sequence entries, part 414.
4598. gbpri415.seq - Primate sequence entries, part 415.
4599. gbpri416.seq - Primate sequence entries, part 416.
4600. gbpri417.seq - Primate sequence entries, part 417.
4601. gbpri418.seq - Primate sequence entries, part 418.
4602. gbpri419.seq - Primate sequence entries, part 419.
4603. gbpri42.seq - Primate sequence entries, part 42.
4604. gbpri420.seq - Primate sequence entries, part 420.
4605. gbpri421.seq - Primate sequence entries, part 421.
4606. gbpri422.seq - Primate sequence entries, part 422.
4607. gbpri423.seq - Primate sequence entries, part 423.
4608. gbpri424.seq - Primate sequence entries, part 424.
4609. gbpri425.seq - Primate sequence entries, part 425.
4610. gbpri426.seq - Primate sequence entries, part 426.
4611. gbpri427.seq - Primate sequence entries, part 427.
4612. gbpri428.seq - Primate sequence entries, part 428.
4613. gbpri429.seq - Primate sequence entries, part 429.
4614. gbpri43.seq - Primate sequence entries, part 43.
4615. gbpri430.seq - Primate sequence entries, part 430.
4616. gbpri431.seq - Primate sequence entries, part 431.
4617. gbpri432.seq - Primate sequence entries, part 432.
4618. gbpri433.seq - Primate sequence entries, part 433.
4619. gbpri434.seq - Primate sequence entries, part 434.
4620. gbpri435.seq - Primate sequence entries, part 435.
4621. gbpri436.seq - Primate sequence entries, part 436.
4622. gbpri437.seq - Primate sequence entries, part 437.
4623. gbpri438.seq - Primate sequence entries, part 438.
4624. gbpri439.seq - Primate sequence entries, part 439.
4625. gbpri44.seq - Primate sequence entries, part 44.
4626. gbpri440.seq - Primate sequence entries, part 440.
4627. gbpri441.seq - Primate sequence entries, part 441.
4628. gbpri442.seq - Primate sequence entries, part 442.
4629. gbpri443.seq - Primate sequence entries, part 443.
4630. gbpri444.seq - Primate sequence entries, part 444.
4631. gbpri445.seq - Primate sequence entries, part 445.
4632. gbpri446.seq - Primate sequence entries, part 446.
4633. gbpri447.seq - Primate sequence entries, part 447.
4634. gbpri448.seq - Primate sequence entries, part 448.
4635. gbpri449.seq - Primate sequence entries, part 449.
4636. gbpri45.seq - Primate sequence entries, part 45.
4637. gbpri450.seq - Primate sequence entries, part 450.
4638. gbpri451.seq - Primate sequence entries, part 451.
4639. gbpri452.seq - Primate sequence entries, part 452.
4640. gbpri453.seq - Primate sequence entries, part 453.
4641. gbpri454.seq - Primate sequence entries, part 454.
4642. gbpri455.seq - Primate sequence entries, part 455.
4643. gbpri456.seq - Primate sequence entries, part 456.
4644. gbpri457.seq - Primate sequence entries, part 457.
4645. gbpri458.seq - Primate sequence entries, part 458.
4646. gbpri459.seq - Primate sequence entries, part 459.
4647. gbpri46.seq - Primate sequence entries, part 46.
4648. gbpri460.seq - Primate sequence entries, part 460.
4649. gbpri461.seq - Primate sequence entries, part 461.
4650. gbpri462.seq - Primate sequence entries, part 462.
4651. gbpri463.seq - Primate sequence entries, part 463.
4652. gbpri464.seq - Primate sequence entries, part 464.
4653. gbpri465.seq - Primate sequence entries, part 465.
4654. gbpri466.seq - Primate sequence entries, part 466.
4655. gbpri467.seq - Primate sequence entries, part 467.
4656. gbpri468.seq - Primate sequence entries, part 468.
4657. gbpri469.seq - Primate sequence entries, part 469.
4658. gbpri47.seq - Primate sequence entries, part 47.
4659. gbpri470.seq - Primate sequence entries, part 470.
4660. gbpri471.seq - Primate sequence entries, part 471.
4661. gbpri472.seq - Primate sequence entries, part 472.
4662. gbpri473.seq - Primate sequence entries, part 473.
4663. gbpri474.seq - Primate sequence entries, part 474.
4664. gbpri475.seq - Primate sequence entries, part 475.
4665. gbpri476.seq - Primate sequence entries, part 476.
4666. gbpri477.seq - Primate sequence entries, part 477.
4667. gbpri478.seq - Primate sequence entries, part 478.
4668. gbpri479.seq - Primate sequence entries, part 479.
4669. gbpri48.seq - Primate sequence entries, part 48.
4670. gbpri480.seq - Primate sequence entries, part 480.
4671. gbpri481.seq - Primate sequence entries, part 481.
4672. gbpri482.seq - Primate sequence entries, part 482.
4673. gbpri483.seq - Primate sequence entries, part 483.
4674. gbpri484.seq - Primate sequence entries, part 484.
4675. gbpri485.seq - Primate sequence entries, part 485.
4676. gbpri486.seq - Primate sequence entries, part 486.
4677. gbpri487.seq - Primate sequence entries, part 487.
4678. gbpri488.seq - Primate sequence entries, part 488.
4679. gbpri489.seq - Primate sequence entries, part 489.
4680. gbpri49.seq - Primate sequence entries, part 49.
4681. gbpri490.seq - Primate sequence entries, part 490.
4682. gbpri491.seq - Primate sequence entries, part 491.
4683. gbpri492.seq - Primate sequence entries, part 492.
4684. gbpri493.seq - Primate sequence entries, part 493.
4685. gbpri494.seq - Primate sequence entries, part 494.
4686. gbpri495.seq - Primate sequence entries, part 495.
4687. gbpri496.seq - Primate sequence entries, part 496.
4688. gbpri497.seq - Primate sequence entries, part 497.
4689. gbpri498.seq - Primate sequence entries, part 498.
4690. gbpri499.seq - Primate sequence entries, part 499.
4691. gbpri5.seq - Primate sequence entries, part 5.
4692. gbpri50.seq - Primate sequence entries, part 50.
4693. gbpri500.seq - Primate sequence entries, part 500.
4694. gbpri501.seq - Primate sequence entries, part 501.
4695. gbpri502.seq - Primate sequence entries, part 502.
4696. gbpri503.seq - Primate sequence entries, part 503.
4697. gbpri504.seq - Primate sequence entries, part 504.
4698. gbpri505.seq - Primate sequence entries, part 505.
4699. gbpri506.seq - Primate sequence entries, part 506.
4700. gbpri507.seq - Primate sequence entries, part 507.
4701. gbpri508.seq - Primate sequence entries, part 508.
4702. gbpri509.seq - Primate sequence entries, part 509.
4703. gbpri51.seq - Primate sequence entries, part 51.
4704. gbpri510.seq - Primate sequence entries, part 510.
4705. gbpri511.seq - Primate sequence entries, part 511.
4706. gbpri512.seq - Primate sequence entries, part 512.
4707. gbpri513.seq - Primate sequence entries, part 513.
4708. gbpri514.seq - Primate sequence entries, part 514.
4709. gbpri515.seq - Primate sequence entries, part 515.
4710. gbpri516.seq - Primate sequence entries, part 516.
4711. gbpri517.seq - Primate sequence entries, part 517.
4712. gbpri518.seq - Primate sequence entries, part 518.
4713. gbpri519.seq - Primate sequence entries, part 519.
4714. gbpri52.seq - Primate sequence entries, part 52.
4715. gbpri520.seq - Primate sequence entries, part 520.
4716. gbpri521.seq - Primate sequence entries, part 521.
4717. gbpri522.seq - Primate sequence entries, part 522.
4718. gbpri523.seq - Primate sequence entries, part 523.
4719. gbpri524.seq - Primate sequence entries, part 524.
4720. gbpri525.seq - Primate sequence entries, part 525.
4721. gbpri526.seq - Primate sequence entries, part 526.
4722. gbpri527.seq - Primate sequence entries, part 527.
4723. gbpri528.seq - Primate sequence entries, part 528.
4724. gbpri529.seq - Primate sequence entries, part 529.
4725. gbpri53.seq - Primate sequence entries, part 53.
4726. gbpri530.seq - Primate sequence entries, part 530.
4727. gbpri531.seq - Primate sequence entries, part 531.
4728. gbpri532.seq - Primate sequence entries, part 532.
4729. gbpri533.seq - Primate sequence entries, part 533.
4730. gbpri534.seq - Primate sequence entries, part 534.
4731. gbpri535.seq - Primate sequence entries, part 535.
4732. gbpri536.seq - Primate sequence entries, part 536.
4733. gbpri537.seq - Primate sequence entries, part 537.
4734. gbpri538.seq - Primate sequence entries, part 538.
4735. gbpri539.seq - Primate sequence entries, part 539.
4736. gbpri54.seq - Primate sequence entries, part 54.
4737. gbpri540.seq - Primate sequence entries, part 540.
4738. gbpri541.seq - Primate sequence entries, part 541.
4739. gbpri542.seq - Primate sequence entries, part 542.
4740. gbpri543.seq - Primate sequence entries, part 543.
4741. gbpri544.seq - Primate sequence entries, part 544.
4742. gbpri545.seq - Primate sequence entries, part 545.
4743. gbpri546.seq - Primate sequence entries, part 546.
4744. gbpri547.seq - Primate sequence entries, part 547.
4745. gbpri548.seq - Primate sequence entries, part 548.
4746. gbpri549.seq - Primate sequence entries, part 549.
4747. gbpri55.seq - Primate sequence entries, part 55.
4748. gbpri550.seq - Primate sequence entries, part 550.
4749. gbpri551.seq - Primate sequence entries, part 551.
4750. gbpri552.seq - Primate sequence entries, part 552.
4751. gbpri553.seq - Primate sequence entries, part 553.
4752. gbpri554.seq - Primate sequence entries, part 554.
4753. gbpri555.seq - Primate sequence entries, part 555.
4754. gbpri556.seq - Primate sequence entries, part 556.
4755. gbpri557.seq - Primate sequence entries, part 557.
4756. gbpri558.seq - Primate sequence entries, part 558.
4757. gbpri559.seq - Primate sequence entries, part 559.
4758. gbpri56.seq - Primate sequence entries, part 56.
4759. gbpri560.seq - Primate sequence entries, part 560.
4760. gbpri561.seq - Primate sequence entries, part 561.
4761. gbpri562.seq - Primate sequence entries, part 562.
4762. gbpri563.seq - Primate sequence entries, part 563.
4763. gbpri564.seq - Primate sequence entries, part 564.
4764. gbpri565.seq - Primate sequence entries, part 565.
4765. gbpri566.seq - Primate sequence entries, part 566.
4766. gbpri567.seq - Primate sequence entries, part 567.
4767. gbpri568.seq - Primate sequence entries, part 568.
4768. gbpri569.seq - Primate sequence entries, part 569.
4769. gbpri57.seq - Primate sequence entries, part 57.
4770. gbpri570.seq - Primate sequence entries, part 570.
4771. gbpri571.seq - Primate sequence entries, part 571.
4772. gbpri572.seq - Primate sequence entries, part 572.
4773. gbpri573.seq - Primate sequence entries, part 573.
4774. gbpri574.seq - Primate sequence entries, part 574.
4775. gbpri575.seq - Primate sequence entries, part 575.
4776. gbpri576.seq - Primate sequence entries, part 576.
4777. gbpri577.seq - Primate sequence entries, part 577.
4778. gbpri578.seq - Primate sequence entries, part 578.
4779. gbpri579.seq - Primate sequence entries, part 579.
4780. gbpri58.seq - Primate sequence entries, part 58.
4781. gbpri580.seq - Primate sequence entries, part 580.
4782. gbpri581.seq - Primate sequence entries, part 581.
4783. gbpri582.seq - Primate sequence entries, part 582.
4784. gbpri583.seq - Primate sequence entries, part 583.
4785. gbpri584.seq - Primate sequence entries, part 584.
4786. gbpri585.seq - Primate sequence entries, part 585.
4787. gbpri586.seq - Primate sequence entries, part 586.
4788. gbpri587.seq - Primate sequence entries, part 587.
4789. gbpri588.seq - Primate sequence entries, part 588.
4790. gbpri589.seq - Primate sequence entries, part 589.
4791. gbpri59.seq - Primate sequence entries, part 59.
4792. gbpri590.seq - Primate sequence entries, part 590.
4793. gbpri591.seq - Primate sequence entries, part 591.
4794. gbpri592.seq - Primate sequence entries, part 592.
4795. gbpri593.seq - Primate sequence entries, part 593.
4796. gbpri594.seq - Primate sequence entries, part 594.
4797. gbpri595.seq - Primate sequence entries, part 595.
4798. gbpri596.seq - Primate sequence entries, part 596.
4799. gbpri597.seq - Primate sequence entries, part 597.
4800. gbpri598.seq - Primate sequence entries, part 598.
4801. gbpri599.seq - Primate sequence entries, part 599.
4802. gbpri6.seq - Primate sequence entries, part 6.
4803. gbpri60.seq - Primate sequence entries, part 60.
4804. gbpri600.seq - Primate sequence entries, part 600.
4805. gbpri601.seq - Primate sequence entries, part 601.
4806. gbpri602.seq - Primate sequence entries, part 602.
4807. gbpri603.seq - Primate sequence entries, part 603.
4808. gbpri604.seq - Primate sequence entries, part 604.
4809. gbpri605.seq - Primate sequence entries, part 605.
4810. gbpri606.seq - Primate sequence entries, part 606.
4811. gbpri607.seq - Primate sequence entries, part 607.
4812. gbpri608.seq - Primate sequence entries, part 608.
4813. gbpri609.seq - Primate sequence entries, part 609.
4814. gbpri61.seq - Primate sequence entries, part 61.
4815. gbpri610.seq - Primate sequence entries, part 610.
4816. gbpri611.seq - Primate sequence entries, part 611.
4817. gbpri612.seq - Primate sequence entries, part 612.
4818. gbpri613.seq - Primate sequence entries, part 613.
4819. gbpri614.seq - Primate sequence entries, part 614.
4820. gbpri615.seq - Primate sequence entries, part 615.
4821. gbpri616.seq - Primate sequence entries, part 616.
4822. gbpri617.seq - Primate sequence entries, part 617.
4823. gbpri618.seq - Primate sequence entries, part 618.
4824. gbpri619.seq - Primate sequence entries, part 619.
4825. gbpri62.seq - Primate sequence entries, part 62.
4826. gbpri620.seq - Primate sequence entries, part 620.
4827. gbpri621.seq - Primate sequence entries, part 621.
4828. gbpri622.seq - Primate sequence entries, part 622.
4829. gbpri623.seq - Primate sequence entries, part 623.
4830. gbpri624.seq - Primate sequence entries, part 624.
4831. gbpri625.seq - Primate sequence entries, part 625.
4832. gbpri626.seq - Primate sequence entries, part 626.
4833. gbpri627.seq - Primate sequence entries, part 627.
4834. gbpri628.seq - Primate sequence entries, part 628.
4835. gbpri629.seq - Primate sequence entries, part 629.
4836. gbpri63.seq - Primate sequence entries, part 63.
4837. gbpri630.seq - Primate sequence entries, part 630.
4838. gbpri631.seq - Primate sequence entries, part 631.
4839. gbpri632.seq - Primate sequence entries, part 632.
4840. gbpri633.seq - Primate sequence entries, part 633.
4841. gbpri634.seq - Primate sequence entries, part 634.
4842. gbpri635.seq - Primate sequence entries, part 635.
4843. gbpri636.seq - Primate sequence entries, part 636.
4844. gbpri637.seq - Primate sequence entries, part 637.
4845. gbpri638.seq - Primate sequence entries, part 638.
4846. gbpri639.seq - Primate sequence entries, part 639.
4847. gbpri64.seq - Primate sequence entries, part 64.
4848. gbpri640.seq - Primate sequence entries, part 640.
4849. gbpri641.seq - Primate sequence entries, part 641.
4850. gbpri642.seq - Primate sequence entries, part 642.
4851. gbpri643.seq - Primate sequence entries, part 643.
4852. gbpri644.seq - Primate sequence entries, part 644.
4853. gbpri645.seq - Primate sequence entries, part 645.
4854. gbpri646.seq - Primate sequence entries, part 646.
4855. gbpri647.seq - Primate sequence entries, part 647.
4856. gbpri648.seq - Primate sequence entries, part 648.
4857. gbpri649.seq - Primate sequence entries, part 649.
4858. gbpri65.seq - Primate sequence entries, part 65.
4859. gbpri650.seq - Primate sequence entries, part 650.
4860. gbpri651.seq - Primate sequence entries, part 651.
4861. gbpri652.seq - Primate sequence entries, part 652.
4862. gbpri653.seq - Primate sequence entries, part 653.
4863. gbpri654.seq - Primate sequence entries, part 654.
4864. gbpri655.seq - Primate sequence entries, part 655.
4865. gbpri656.seq - Primate sequence entries, part 656.
4866. gbpri657.seq - Primate sequence entries, part 657.
4867. gbpri658.seq - Primate sequence entries, part 658.
4868. gbpri659.seq - Primate sequence entries, part 659.
4869. gbpri66.seq - Primate sequence entries, part 66.
4870. gbpri660.seq - Primate sequence entries, part 660.
4871. gbpri661.seq - Primate sequence entries, part 661.
4872. gbpri662.seq - Primate sequence entries, part 662.
4873. gbpri663.seq - Primate sequence entries, part 663.
4874. gbpri664.seq - Primate sequence entries, part 664.
4875. gbpri665.seq - Primate sequence entries, part 665.
4876. gbpri666.seq - Primate sequence entries, part 666.
4877. gbpri667.seq - Primate sequence entries, part 667.
4878. gbpri668.seq - Primate sequence entries, part 668.
4879. gbpri669.seq - Primate sequence entries, part 669.
4880. gbpri67.seq - Primate sequence entries, part 67.
4881. gbpri670.seq - Primate sequence entries, part 670.
4882. gbpri671.seq - Primate sequence entries, part 671.
4883. gbpri672.seq - Primate sequence entries, part 672.
4884. gbpri673.seq - Primate sequence entries, part 673.
4885. gbpri674.seq - Primate sequence entries, part 674.
4886. gbpri675.seq - Primate sequence entries, part 675.
4887. gbpri676.seq - Primate sequence entries, part 676.
4888. gbpri677.seq - Primate sequence entries, part 677.
4889. gbpri678.seq - Primate sequence entries, part 678.
4890. gbpri68.seq - Primate sequence entries, part 68.
4891. gbpri69.seq - Primate sequence entries, part 69.
4892. gbpri7.seq - Primate sequence entries, part 7.
4893. gbpri70.seq - Primate sequence entries, part 70.
4894. gbpri71.seq - Primate sequence entries, part 71.
4895. gbpri72.seq - Primate sequence entries, part 72.
4896. gbpri73.seq - Primate sequence entries, part 73.
4897. gbpri74.seq - Primate sequence entries, part 74.
4898. gbpri75.seq - Primate sequence entries, part 75.
4899. gbpri76.seq - Primate sequence entries, part 76.
4900. gbpri77.seq - Primate sequence entries, part 77.
4901. gbpri78.seq - Primate sequence entries, part 78.
4902. gbpri79.seq - Primate sequence entries, part 79.
4903. gbpri8.seq - Primate sequence entries, part 8.
4904. gbpri80.seq - Primate sequence entries, part 80.
4905. gbpri81.seq - Primate sequence entries, part 81.
4906. gbpri82.seq - Primate sequence entries, part 82.
4907. gbpri83.seq - Primate sequence entries, part 83.
4908. gbpri84.seq - Primate sequence entries, part 84.
4909. gbpri85.seq - Primate sequence entries, part 85.
4910. gbpri86.seq - Primate sequence entries, part 86.
4911. gbpri87.seq - Primate sequence entries, part 87.
4912. gbpri88.seq - Primate sequence entries, part 88.
4913. gbpri89.seq - Primate sequence entries, part 89.
4914. gbpri9.seq - Primate sequence entries, part 9.
4915. gbpri90.seq - Primate sequence entries, part 90.
4916. gbpri91.seq - Primate sequence entries, part 91.
4917. gbpri92.seq - Primate sequence entries, part 92.
4918. gbpri93.seq - Primate sequence entries, part 93.
4919. gbpri94.seq - Primate sequence entries, part 94.
4920. gbpri95.seq - Primate sequence entries, part 95.
4921. gbpri96.seq - Primate sequence entries, part 96.
4922. gbpri97.seq - Primate sequence entries, part 97.
4923. gbpri98.seq - Primate sequence entries, part 98.
4924. gbpri99.seq - Primate sequence entries, part 99.
4925. gbrel.txt - Release notes (this document).
4926. gbrod1.seq - Rodent sequence entries, part 1.
4927. gbrod10.seq - Rodent sequence entries, part 10.
4928. gbrod100.seq - Rodent sequence entries, part 100.
4929. gbrod101.seq - Rodent sequence entries, part 101.
4930. gbrod102.seq - Rodent sequence entries, part 102.
4931. gbrod103.seq - Rodent sequence entries, part 103.
4932. gbrod104.seq - Rodent sequence entries, part 104.
4933. gbrod105.seq - Rodent sequence entries, part 105.
4934. gbrod106.seq - Rodent sequence entries, part 106.
4935. gbrod107.seq - Rodent sequence entries, part 107.
4936. gbrod108.seq - Rodent sequence entries, part 108.
4937. gbrod109.seq - Rodent sequence entries, part 109.
4938. gbrod11.seq - Rodent sequence entries, part 11.
4939. gbrod110.seq - Rodent sequence entries, part 110.
4940. gbrod111.seq - Rodent sequence entries, part 111.
4941. gbrod112.seq - Rodent sequence entries, part 112.
4942. gbrod113.seq - Rodent sequence entries, part 113.
4943. gbrod114.seq - Rodent sequence entries, part 114.
4944. gbrod115.seq - Rodent sequence entries, part 115.
4945. gbrod12.seq - Rodent sequence entries, part 12.
4946. gbrod13.seq - Rodent sequence entries, part 13.
4947. gbrod14.seq - Rodent sequence entries, part 14.
4948. gbrod15.seq - Rodent sequence entries, part 15.
4949. gbrod16.seq - Rodent sequence entries, part 16.
4950. gbrod17.seq - Rodent sequence entries, part 17.
4951. gbrod18.seq - Rodent sequence entries, part 18.
4952. gbrod19.seq - Rodent sequence entries, part 19.
4953. gbrod2.seq - Rodent sequence entries, part 2.
4954. gbrod20.seq - Rodent sequence entries, part 20.
4955. gbrod21.seq - Rodent sequence entries, part 21.
4956. gbrod22.seq - Rodent sequence entries, part 22.
4957. gbrod23.seq - Rodent sequence entries, part 23.
4958. gbrod24.seq - Rodent sequence entries, part 24.
4959. gbrod25.seq - Rodent sequence entries, part 25.
4960. gbrod26.seq - Rodent sequence entries, part 26.
4961. gbrod27.seq - Rodent sequence entries, part 27.
4962. gbrod28.seq - Rodent sequence entries, part 28.
4963. gbrod29.seq - Rodent sequence entries, part 29.
4964. gbrod3.seq - Rodent sequence entries, part 3.
4965. gbrod30.seq - Rodent sequence entries, part 30.
4966. gbrod31.seq - Rodent sequence entries, part 31.
4967. gbrod32.seq - Rodent sequence entries, part 32.
4968. gbrod33.seq - Rodent sequence entries, part 33.
4969. gbrod34.seq - Rodent sequence entries, part 34.
4970. gbrod35.seq - Rodent sequence entries, part 35.
4971. gbrod36.seq - Rodent sequence entries, part 36.
4972. gbrod37.seq - Rodent sequence entries, part 37.
4973. gbrod38.seq - Rodent sequence entries, part 38.
4974. gbrod39.seq - Rodent sequence entries, part 39.
4975. gbrod4.seq - Rodent sequence entries, part 4.
4976. gbrod40.seq - Rodent sequence entries, part 40.
4977. gbrod41.seq - Rodent sequence entries, part 41.
4978. gbrod42.seq - Rodent sequence entries, part 42.
4979. gbrod43.seq - Rodent sequence entries, part 43.
4980. gbrod44.seq - Rodent sequence entries, part 44.
4981. gbrod45.seq - Rodent sequence entries, part 45.
4982. gbrod46.seq - Rodent sequence entries, part 46.
4983. gbrod47.seq - Rodent sequence entries, part 47.
4984. gbrod48.seq - Rodent sequence entries, part 48.
4985. gbrod49.seq - Rodent sequence entries, part 49.
4986. gbrod5.seq - Rodent sequence entries, part 5.
4987. gbrod50.seq - Rodent sequence entries, part 50.
4988. gbrod51.seq - Rodent sequence entries, part 51.
4989. gbrod52.seq - Rodent sequence entries, part 52.
4990. gbrod53.seq - Rodent sequence entries, part 53.
4991. gbrod54.seq - Rodent sequence entries, part 54.
4992. gbrod55.seq - Rodent sequence entries, part 55.
4993. gbrod56.seq - Rodent sequence entries, part 56.
4994. gbrod57.seq - Rodent sequence entries, part 57.
4995. gbrod58.seq - Rodent sequence entries, part 58.
4996. gbrod59.seq - Rodent sequence entries, part 59.
4997. gbrod6.seq - Rodent sequence entries, part 6.
4998. gbrod60.seq - Rodent sequence entries, part 60.
4999. gbrod61.seq - Rodent sequence entries, part 61.
5000. gbrod62.seq - Rodent sequence entries, part 62.
5001. gbrod63.seq - Rodent sequence entries, part 63.
5002. gbrod64.seq - Rodent sequence entries, part 64.
5003. gbrod65.seq - Rodent sequence entries, part 65.
5004. gbrod66.seq - Rodent sequence entries, part 66.
5005. gbrod67.seq - Rodent sequence entries, part 67.
5006. gbrod68.seq - Rodent sequence entries, part 68.
5007. gbrod69.seq - Rodent sequence entries, part 69.
5008. gbrod7.seq - Rodent sequence entries, part 7.
5009. gbrod70.seq - Rodent sequence entries, part 70.
5010. gbrod71.seq - Rodent sequence entries, part 71.
5011. gbrod72.seq - Rodent sequence entries, part 72.
5012. gbrod73.seq - Rodent sequence entries, part 73.
5013. gbrod74.seq - Rodent sequence entries, part 74.
5014. gbrod75.seq - Rodent sequence entries, part 75.
5015. gbrod76.seq - Rodent sequence entries, part 76.
5016. gbrod77.seq - Rodent sequence entries, part 77.
5017. gbrod78.seq - Rodent sequence entries, part 78.
5018. gbrod79.seq - Rodent sequence entries, part 79.
5019. gbrod8.seq - Rodent sequence entries, part 8.
5020. gbrod80.seq - Rodent sequence entries, part 80.
5021. gbrod81.seq - Rodent sequence entries, part 81.
5022. gbrod82.seq - Rodent sequence entries, part 82.
5023. gbrod83.seq - Rodent sequence entries, part 83.
5024. gbrod84.seq - Rodent sequence entries, part 84.
5025. gbrod85.seq - Rodent sequence entries, part 85.
5026. gbrod86.seq - Rodent sequence entries, part 86.
5027. gbrod87.seq - Rodent sequence entries, part 87.
5028. gbrod88.seq - Rodent sequence entries, part 88.
5029. gbrod89.seq - Rodent sequence entries, part 89.
5030. gbrod9.seq - Rodent sequence entries, part 9.
5031. gbrod90.seq - Rodent sequence entries, part 90.
5032. gbrod91.seq - Rodent sequence entries, part 91.
5033. gbrod92.seq - Rodent sequence entries, part 92.
5034. gbrod93.seq - Rodent sequence entries, part 93.
5035. gbrod94.seq - Rodent sequence entries, part 94.
5036. gbrod95.seq - Rodent sequence entries, part 95.
5037. gbrod96.seq - Rodent sequence entries, part 96.
5038. gbrod97.seq - Rodent sequence entries, part 97.
5039. gbrod98.seq - Rodent sequence entries, part 98.
5040. gbrod99.seq - Rodent sequence entries, part 99.
5041. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
5042. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
5043. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
5044. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
5045. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
5046. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
5047. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
5048. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
5049. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
5050. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
5051. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
5052. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
5053. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
5054. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
5055. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
5056. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
5057. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
5058. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
5059. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
5060. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
5061. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
5062. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
5063. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
5064. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
5065. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
5066. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
5067. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
5068. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
5069. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
5070. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
5071. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
5072. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
5073. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
5074. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
5075. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
5076. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
5077. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
5078. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
5079. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
5080. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
5081. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
5082. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
5083. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
5084. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
5085. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
5086. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
5087. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
5088. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
5089. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
5090. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
5091. gbuna1.seq - Unannotated sequence entries, part 1.
5092. gbvrl1.seq - Viral sequence entries, part 1.
5093. gbvrl10.seq - Viral sequence entries, part 10.
5094. gbvrl100.seq - Viral sequence entries, part 100.
5095. gbvrl101.seq - Viral sequence entries, part 101.
5096. gbvrl102.seq - Viral sequence entries, part 102.
5097. gbvrl103.seq - Viral sequence entries, part 103.
5098. gbvrl104.seq - Viral sequence entries, part 104.
5099. gbvrl105.seq - Viral sequence entries, part 105.
5100. gbvrl106.seq - Viral sequence entries, part 106.
5101. gbvrl107.seq - Viral sequence entries, part 107.
5102. gbvrl108.seq - Viral sequence entries, part 108.
5103. gbvrl109.seq - Viral sequence entries, part 109.
5104. gbvrl11.seq - Viral sequence entries, part 11.
5105. gbvrl110.seq - Viral sequence entries, part 110.
5106. gbvrl111.seq - Viral sequence entries, part 111.
5107. gbvrl112.seq - Viral sequence entries, part 112.
5108. gbvrl113.seq - Viral sequence entries, part 113.
5109. gbvrl114.seq - Viral sequence entries, part 114.
5110. gbvrl115.seq - Viral sequence entries, part 115.
5111. gbvrl116.seq - Viral sequence entries, part 116.
5112. gbvrl117.seq - Viral sequence entries, part 117.
5113. gbvrl118.seq - Viral sequence entries, part 118.
5114. gbvrl119.seq - Viral sequence entries, part 119.
5115. gbvrl12.seq - Viral sequence entries, part 12.
5116. gbvrl120.seq - Viral sequence entries, part 120.
5117. gbvrl121.seq - Viral sequence entries, part 121.
5118. gbvrl122.seq - Viral sequence entries, part 122.
5119. gbvrl123.seq - Viral sequence entries, part 123.
5120. gbvrl124.seq - Viral sequence entries, part 124.
5121. gbvrl125.seq - Viral sequence entries, part 125.
5122. gbvrl126.seq - Viral sequence entries, part 126.
5123. gbvrl127.seq - Viral sequence entries, part 127.
5124. gbvrl128.seq - Viral sequence entries, part 128.
5125. gbvrl129.seq - Viral sequence entries, part 129.
5126. gbvrl13.seq - Viral sequence entries, part 13.
5127. gbvrl130.seq - Viral sequence entries, part 130.
5128. gbvrl131.seq - Viral sequence entries, part 131.
5129. gbvrl132.seq - Viral sequence entries, part 132.
5130. gbvrl133.seq - Viral sequence entries, part 133.
5131. gbvrl134.seq - Viral sequence entries, part 134.
5132. gbvrl135.seq - Viral sequence entries, part 135.
5133. gbvrl136.seq - Viral sequence entries, part 136.
5134. gbvrl137.seq - Viral sequence entries, part 137.
5135. gbvrl138.seq - Viral sequence entries, part 138.
5136. gbvrl139.seq - Viral sequence entries, part 139.
5137. gbvrl14.seq - Viral sequence entries, part 14.
5138. gbvrl140.seq - Viral sequence entries, part 140.
5139. gbvrl141.seq - Viral sequence entries, part 141.
5140. gbvrl142.seq - Viral sequence entries, part 142.
5141. gbvrl143.seq - Viral sequence entries, part 143.
5142. gbvrl144.seq - Viral sequence entries, part 144.
5143. gbvrl145.seq - Viral sequence entries, part 145.
5144. gbvrl146.seq - Viral sequence entries, part 146.
5145. gbvrl147.seq - Viral sequence entries, part 147.
5146. gbvrl148.seq - Viral sequence entries, part 148.
5147. gbvrl149.seq - Viral sequence entries, part 149.
5148. gbvrl15.seq - Viral sequence entries, part 15.
5149. gbvrl150.seq - Viral sequence entries, part 150.
5150. gbvrl151.seq - Viral sequence entries, part 151.
5151. gbvrl152.seq - Viral sequence entries, part 152.
5152. gbvrl153.seq - Viral sequence entries, part 153.
5153. gbvrl154.seq - Viral sequence entries, part 154.
5154. gbvrl155.seq - Viral sequence entries, part 155.
5155. gbvrl156.seq - Viral sequence entries, part 156.
5156. gbvrl157.seq - Viral sequence entries, part 157.
5157. gbvrl158.seq - Viral sequence entries, part 158.
5158. gbvrl159.seq - Viral sequence entries, part 159.
5159. gbvrl16.seq - Viral sequence entries, part 16.
5160. gbvrl160.seq - Viral sequence entries, part 160.
5161. gbvrl161.seq - Viral sequence entries, part 161.
5162. gbvrl162.seq - Viral sequence entries, part 162.
5163. gbvrl163.seq - Viral sequence entries, part 163.
5164. gbvrl164.seq - Viral sequence entries, part 164.
5165. gbvrl165.seq - Viral sequence entries, part 165.
5166. gbvrl166.seq - Viral sequence entries, part 166.
5167. gbvrl167.seq - Viral sequence entries, part 167.
5168. gbvrl168.seq - Viral sequence entries, part 168.
5169. gbvrl169.seq - Viral sequence entries, part 169.
5170. gbvrl17.seq - Viral sequence entries, part 17.
5171. gbvrl170.seq - Viral sequence entries, part 170.
5172. gbvrl171.seq - Viral sequence entries, part 171.
5173. gbvrl172.seq - Viral sequence entries, part 172.
5174. gbvrl173.seq - Viral sequence entries, part 173.
5175. gbvrl174.seq - Viral sequence entries, part 174.
5176. gbvrl175.seq - Viral sequence entries, part 175.
5177. gbvrl176.seq - Viral sequence entries, part 176.
5178. gbvrl177.seq - Viral sequence entries, part 177.
5179. gbvrl178.seq - Viral sequence entries, part 178.
5180. gbvrl179.seq - Viral sequence entries, part 179.
5181. gbvrl18.seq - Viral sequence entries, part 18.
5182. gbvrl180.seq - Viral sequence entries, part 180.
5183. gbvrl181.seq - Viral sequence entries, part 181.
5184. gbvrl182.seq - Viral sequence entries, part 182.
5185. gbvrl183.seq - Viral sequence entries, part 183.
5186. gbvrl184.seq - Viral sequence entries, part 184.
5187. gbvrl185.seq - Viral sequence entries, part 185.
5188. gbvrl186.seq - Viral sequence entries, part 186.
5189. gbvrl187.seq - Viral sequence entries, part 187.
5190. gbvrl188.seq - Viral sequence entries, part 188.
5191. gbvrl189.seq - Viral sequence entries, part 189.
5192. gbvrl19.seq - Viral sequence entries, part 19.
5193. gbvrl190.seq - Viral sequence entries, part 190.
5194. gbvrl191.seq - Viral sequence entries, part 191.
5195. gbvrl192.seq - Viral sequence entries, part 192.
5196. gbvrl193.seq - Viral sequence entries, part 193.
5197. gbvrl194.seq - Viral sequence entries, part 194.
5198. gbvrl195.seq - Viral sequence entries, part 195.
5199. gbvrl196.seq - Viral sequence entries, part 196.
5200. gbvrl197.seq - Viral sequence entries, part 197.
5201. gbvrl198.seq - Viral sequence entries, part 198.
5202. gbvrl199.seq - Viral sequence entries, part 199.
5203. gbvrl2.seq - Viral sequence entries, part 2.
5204. gbvrl20.seq - Viral sequence entries, part 20.
5205. gbvrl200.seq - Viral sequence entries, part 200.
5206. gbvrl201.seq - Viral sequence entries, part 201.
5207. gbvrl202.seq - Viral sequence entries, part 202.
5208. gbvrl203.seq - Viral sequence entries, part 203.
5209. gbvrl204.seq - Viral sequence entries, part 204.
5210. gbvrl205.seq - Viral sequence entries, part 205.
5211. gbvrl206.seq - Viral sequence entries, part 206.
5212. gbvrl207.seq - Viral sequence entries, part 207.
5213. gbvrl208.seq - Viral sequence entries, part 208.
5214. gbvrl209.seq - Viral sequence entries, part 209.
5215. gbvrl21.seq - Viral sequence entries, part 21.
5216. gbvrl210.seq - Viral sequence entries, part 210.
5217. gbvrl211.seq - Viral sequence entries, part 211.
5218. gbvrl212.seq - Viral sequence entries, part 212.
5219. gbvrl213.seq - Viral sequence entries, part 213.
5220. gbvrl214.seq - Viral sequence entries, part 214.
5221. gbvrl215.seq - Viral sequence entries, part 215.
5222. gbvrl216.seq - Viral sequence entries, part 216.
5223. gbvrl217.seq - Viral sequence entries, part 217.
5224. gbvrl218.seq - Viral sequence entries, part 218.
5225. gbvrl219.seq - Viral sequence entries, part 219.
5226. gbvrl22.seq - Viral sequence entries, part 22.
5227. gbvrl220.seq - Viral sequence entries, part 220.
5228. gbvrl221.seq - Viral sequence entries, part 221.
5229. gbvrl222.seq - Viral sequence entries, part 222.
5230. gbvrl223.seq - Viral sequence entries, part 223.
5231. gbvrl224.seq - Viral sequence entries, part 224.
5232. gbvrl225.seq - Viral sequence entries, part 225.
5233. gbvrl226.seq - Viral sequence entries, part 226.
5234. gbvrl227.seq - Viral sequence entries, part 227.
5235. gbvrl228.seq - Viral sequence entries, part 228.
5236. gbvrl229.seq - Viral sequence entries, part 229.
5237. gbvrl23.seq - Viral sequence entries, part 23.
5238. gbvrl230.seq - Viral sequence entries, part 230.
5239. gbvrl231.seq - Viral sequence entries, part 231.
5240. gbvrl232.seq - Viral sequence entries, part 232.
5241. gbvrl233.seq - Viral sequence entries, part 233.
5242. gbvrl234.seq - Viral sequence entries, part 234.
5243. gbvrl235.seq - Viral sequence entries, part 235.
5244. gbvrl236.seq - Viral sequence entries, part 236.
5245. gbvrl237.seq - Viral sequence entries, part 237.
5246. gbvrl238.seq - Viral sequence entries, part 238.
5247. gbvrl239.seq - Viral sequence entries, part 239.
5248. gbvrl24.seq - Viral sequence entries, part 24.
5249. gbvrl240.seq - Viral sequence entries, part 240.
5250. gbvrl241.seq - Viral sequence entries, part 241.
5251. gbvrl242.seq - Viral sequence entries, part 242.
5252. gbvrl243.seq - Viral sequence entries, part 243.
5253. gbvrl244.seq - Viral sequence entries, part 244.
5254. gbvrl245.seq - Viral sequence entries, part 245.
5255. gbvrl246.seq - Viral sequence entries, part 246.
5256. gbvrl247.seq - Viral sequence entries, part 247.
5257. gbvrl248.seq - Viral sequence entries, part 248.
5258. gbvrl249.seq - Viral sequence entries, part 249.
5259. gbvrl25.seq - Viral sequence entries, part 25.
5260. gbvrl250.seq - Viral sequence entries, part 250.
5261. gbvrl251.seq - Viral sequence entries, part 251.
5262. gbvrl252.seq - Viral sequence entries, part 252.
5263. gbvrl253.seq - Viral sequence entries, part 253.
5264. gbvrl254.seq - Viral sequence entries, part 254.
5265. gbvrl255.seq - Viral sequence entries, part 255.
5266. gbvrl256.seq - Viral sequence entries, part 256.
5267. gbvrl257.seq - Viral sequence entries, part 257.
5268. gbvrl258.seq - Viral sequence entries, part 258.
5269. gbvrl259.seq - Viral sequence entries, part 259.
5270. gbvrl26.seq - Viral sequence entries, part 26.
5271. gbvrl260.seq - Viral sequence entries, part 260.
5272. gbvrl261.seq - Viral sequence entries, part 261.
5273. gbvrl262.seq - Viral sequence entries, part 262.
5274. gbvrl263.seq - Viral sequence entries, part 263.
5275. gbvrl264.seq - Viral sequence entries, part 264.
5276. gbvrl265.seq - Viral sequence entries, part 265.
5277. gbvrl266.seq - Viral sequence entries, part 266.
5278. gbvrl267.seq - Viral sequence entries, part 267.
5279. gbvrl268.seq - Viral sequence entries, part 268.
5280. gbvrl269.seq - Viral sequence entries, part 269.
5281. gbvrl27.seq - Viral sequence entries, part 27.
5282. gbvrl270.seq - Viral sequence entries, part 270.
5283. gbvrl271.seq - Viral sequence entries, part 271.
5284. gbvrl272.seq - Viral sequence entries, part 272.
5285. gbvrl273.seq - Viral sequence entries, part 273.
5286. gbvrl274.seq - Viral sequence entries, part 274.
5287. gbvrl275.seq - Viral sequence entries, part 275.
5288. gbvrl276.seq - Viral sequence entries, part 276.
5289. gbvrl277.seq - Viral sequence entries, part 277.
5290. gbvrl278.seq - Viral sequence entries, part 278.
5291. gbvrl279.seq - Viral sequence entries, part 279.
5292. gbvrl28.seq - Viral sequence entries, part 28.
5293. gbvrl280.seq - Viral sequence entries, part 280.
5294. gbvrl281.seq - Viral sequence entries, part 281.
5295. gbvrl282.seq - Viral sequence entries, part 282.
5296. gbvrl283.seq - Viral sequence entries, part 283.
5297. gbvrl284.seq - Viral sequence entries, part 284.
5298. gbvrl285.seq - Viral sequence entries, part 285.
5299. gbvrl286.seq - Viral sequence entries, part 286.
5300. gbvrl287.seq - Viral sequence entries, part 287.
5301. gbvrl288.seq - Viral sequence entries, part 288.
5302. gbvrl289.seq - Viral sequence entries, part 289.
5303. gbvrl29.seq - Viral sequence entries, part 29.
5304. gbvrl290.seq - Viral sequence entries, part 290.
5305. gbvrl291.seq - Viral sequence entries, part 291.
5306. gbvrl292.seq - Viral sequence entries, part 292.
5307. gbvrl293.seq - Viral sequence entries, part 293.
5308. gbvrl294.seq - Viral sequence entries, part 294.
5309. gbvrl295.seq - Viral sequence entries, part 295.
5310. gbvrl296.seq - Viral sequence entries, part 296.
5311. gbvrl297.seq - Viral sequence entries, part 297.
5312. gbvrl298.seq - Viral sequence entries, part 298.
5313. gbvrl299.seq - Viral sequence entries, part 299.
5314. gbvrl3.seq - Viral sequence entries, part 3.
5315. gbvrl30.seq - Viral sequence entries, part 30.
5316. gbvrl300.seq - Viral sequence entries, part 300.
5317. gbvrl301.seq - Viral sequence entries, part 301.
5318. gbvrl302.seq - Viral sequence entries, part 302.
5319. gbvrl303.seq - Viral sequence entries, part 303.
5320. gbvrl304.seq - Viral sequence entries, part 304.
5321. gbvrl305.seq - Viral sequence entries, part 305.
5322. gbvrl306.seq - Viral sequence entries, part 306.
5323. gbvrl307.seq - Viral sequence entries, part 307.
5324. gbvrl308.seq - Viral sequence entries, part 308.
5325. gbvrl309.seq - Viral sequence entries, part 309.
5326. gbvrl31.seq - Viral sequence entries, part 31.
5327. gbvrl310.seq - Viral sequence entries, part 310.
5328. gbvrl311.seq - Viral sequence entries, part 311.
5329. gbvrl312.seq - Viral sequence entries, part 312.
5330. gbvrl313.seq - Viral sequence entries, part 313.
5331. gbvrl314.seq - Viral sequence entries, part 314.
5332. gbvrl315.seq - Viral sequence entries, part 315.
5333. gbvrl316.seq - Viral sequence entries, part 316.
5334. gbvrl317.seq - Viral sequence entries, part 317.
5335. gbvrl318.seq - Viral sequence entries, part 318.
5336. gbvrl319.seq - Viral sequence entries, part 319.
5337. gbvrl32.seq - Viral sequence entries, part 32.
5338. gbvrl320.seq - Viral sequence entries, part 320.
5339. gbvrl321.seq - Viral sequence entries, part 321.
5340. gbvrl322.seq - Viral sequence entries, part 322.
5341. gbvrl323.seq - Viral sequence entries, part 323.
5342. gbvrl324.seq - Viral sequence entries, part 324.
5343. gbvrl325.seq - Viral sequence entries, part 325.
5344. gbvrl326.seq - Viral sequence entries, part 326.
5345. gbvrl327.seq - Viral sequence entries, part 327.
5346. gbvrl328.seq - Viral sequence entries, part 328.
5347. gbvrl329.seq - Viral sequence entries, part 329.
5348. gbvrl33.seq - Viral sequence entries, part 33.
5349. gbvrl330.seq - Viral sequence entries, part 330.
5350. gbvrl331.seq - Viral sequence entries, part 331.
5351. gbvrl332.seq - Viral sequence entries, part 332.
5352. gbvrl333.seq - Viral sequence entries, part 333.
5353. gbvrl334.seq - Viral sequence entries, part 334.
5354. gbvrl335.seq - Viral sequence entries, part 335.
5355. gbvrl336.seq - Viral sequence entries, part 336.
5356. gbvrl337.seq - Viral sequence entries, part 337.
5357. gbvrl34.seq - Viral sequence entries, part 34.
5358. gbvrl35.seq - Viral sequence entries, part 35.
5359. gbvrl36.seq - Viral sequence entries, part 36.
5360. gbvrl37.seq - Viral sequence entries, part 37.
5361. gbvrl38.seq - Viral sequence entries, part 38.
5362. gbvrl39.seq - Viral sequence entries, part 39.
5363. gbvrl4.seq - Viral sequence entries, part 4.
5364. gbvrl40.seq - Viral sequence entries, part 40.
5365. gbvrl41.seq - Viral sequence entries, part 41.
5366. gbvrl42.seq - Viral sequence entries, part 42.
5367. gbvrl43.seq - Viral sequence entries, part 43.
5368. gbvrl44.seq - Viral sequence entries, part 44.
5369. gbvrl45.seq - Viral sequence entries, part 45.
5370. gbvrl46.seq - Viral sequence entries, part 46.
5371. gbvrl47.seq - Viral sequence entries, part 47.
5372. gbvrl48.seq - Viral sequence entries, part 48.
5373. gbvrl49.seq - Viral sequence entries, part 49.
5374. gbvrl5.seq - Viral sequence entries, part 5.
5375. gbvrl50.seq - Viral sequence entries, part 50.
5376. gbvrl51.seq - Viral sequence entries, part 51.
5377. gbvrl52.seq - Viral sequence entries, part 52.
5378. gbvrl53.seq - Viral sequence entries, part 53.
5379. gbvrl54.seq - Viral sequence entries, part 54.
5380. gbvrl55.seq - Viral sequence entries, part 55.
5381. gbvrl56.seq - Viral sequence entries, part 56.
5382. gbvrl57.seq - Viral sequence entries, part 57.
5383. gbvrl58.seq - Viral sequence entries, part 58.
5384. gbvrl59.seq - Viral sequence entries, part 59.
5385. gbvrl6.seq - Viral sequence entries, part 6.
5386. gbvrl60.seq - Viral sequence entries, part 60.
5387. gbvrl61.seq - Viral sequence entries, part 61.
5388. gbvrl62.seq - Viral sequence entries, part 62.
5389. gbvrl63.seq - Viral sequence entries, part 63.
5390. gbvrl64.seq - Viral sequence entries, part 64.
5391. gbvrl65.seq - Viral sequence entries, part 65.
5392. gbvrl66.seq - Viral sequence entries, part 66.
5393. gbvrl67.seq - Viral sequence entries, part 67.
5394. gbvrl68.seq - Viral sequence entries, part 68.
5395. gbvrl69.seq - Viral sequence entries, part 69.
5396. gbvrl7.seq - Viral sequence entries, part 7.
5397. gbvrl70.seq - Viral sequence entries, part 70.
5398. gbvrl71.seq - Viral sequence entries, part 71.
5399. gbvrl72.seq - Viral sequence entries, part 72.
5400. gbvrl73.seq - Viral sequence entries, part 73.
5401. gbvrl74.seq - Viral sequence entries, part 74.
5402. gbvrl75.seq - Viral sequence entries, part 75.
5403. gbvrl76.seq - Viral sequence entries, part 76.
5404. gbvrl77.seq - Viral sequence entries, part 77.
5405. gbvrl78.seq - Viral sequence entries, part 78.
5406. gbvrl79.seq - Viral sequence entries, part 79.
5407. gbvrl8.seq - Viral sequence entries, part 8.
5408. gbvrl80.seq - Viral sequence entries, part 80.
5409. gbvrl81.seq - Viral sequence entries, part 81.
5410. gbvrl82.seq - Viral sequence entries, part 82.
5411. gbvrl83.seq - Viral sequence entries, part 83.
5412. gbvrl84.seq - Viral sequence entries, part 84.
5413. gbvrl85.seq - Viral sequence entries, part 85.
5414. gbvrl86.seq - Viral sequence entries, part 86.
5415. gbvrl87.seq - Viral sequence entries, part 87.
5416. gbvrl88.seq - Viral sequence entries, part 88.
5417. gbvrl89.seq - Viral sequence entries, part 89.
5418. gbvrl9.seq - Viral sequence entries, part 9.
5419. gbvrl90.seq - Viral sequence entries, part 90.
5420. gbvrl91.seq - Viral sequence entries, part 91.
5421. gbvrl92.seq - Viral sequence entries, part 92.
5422. gbvrl93.seq - Viral sequence entries, part 93.
5423. gbvrl94.seq - Viral sequence entries, part 94.
5424. gbvrl95.seq - Viral sequence entries, part 95.
5425. gbvrl96.seq - Viral sequence entries, part 96.
5426. gbvrl97.seq - Viral sequence entries, part 97.
5427. gbvrl98.seq - Viral sequence entries, part 98.
5428. gbvrl99.seq - Viral sequence entries, part 99.
5429. gbvrt1.seq - Other vertebrate sequence entries, part 1.
5430. gbvrt10.seq - Other vertebrate sequence entries, part 10.
5431. gbvrt100.seq - Other vertebrate sequence entries, part 100.
5432. gbvrt101.seq - Other vertebrate sequence entries, part 101.
5433. gbvrt102.seq - Other vertebrate sequence entries, part 102.
5434. gbvrt103.seq - Other vertebrate sequence entries, part 103.
5435. gbvrt104.seq - Other vertebrate sequence entries, part 104.
5436. gbvrt105.seq - Other vertebrate sequence entries, part 105.
5437. gbvrt106.seq - Other vertebrate sequence entries, part 106.
5438. gbvrt107.seq - Other vertebrate sequence entries, part 107.
5439. gbvrt108.seq - Other vertebrate sequence entries, part 108.
5440. gbvrt109.seq - Other vertebrate sequence entries, part 109.
5441. gbvrt11.seq - Other vertebrate sequence entries, part 11.
5442. gbvrt110.seq - Other vertebrate sequence entries, part 110.
5443. gbvrt111.seq - Other vertebrate sequence entries, part 111.
5444. gbvrt112.seq - Other vertebrate sequence entries, part 112.
5445. gbvrt113.seq - Other vertebrate sequence entries, part 113.
5446. gbvrt114.seq - Other vertebrate sequence entries, part 114.
5447. gbvrt115.seq - Other vertebrate sequence entries, part 115.
5448. gbvrt116.seq - Other vertebrate sequence entries, part 116.
5449. gbvrt117.seq - Other vertebrate sequence entries, part 117.
5450. gbvrt118.seq - Other vertebrate sequence entries, part 118.
5451. gbvrt119.seq - Other vertebrate sequence entries, part 119.
5452. gbvrt12.seq - Other vertebrate sequence entries, part 12.
5453. gbvrt120.seq - Other vertebrate sequence entries, part 120.
5454. gbvrt121.seq - Other vertebrate sequence entries, part 121.
5455. gbvrt122.seq - Other vertebrate sequence entries, part 122.
5456. gbvrt123.seq - Other vertebrate sequence entries, part 123.
5457. gbvrt124.seq - Other vertebrate sequence entries, part 124.
5458. gbvrt125.seq - Other vertebrate sequence entries, part 125.
5459. gbvrt126.seq - Other vertebrate sequence entries, part 126.
5460. gbvrt127.seq - Other vertebrate sequence entries, part 127.
5461. gbvrt128.seq - Other vertebrate sequence entries, part 128.
5462. gbvrt129.seq - Other vertebrate sequence entries, part 129.
5463. gbvrt13.seq - Other vertebrate sequence entries, part 13.
5464. gbvrt130.seq - Other vertebrate sequence entries, part 130.
5465. gbvrt131.seq - Other vertebrate sequence entries, part 131.
5466. gbvrt132.seq - Other vertebrate sequence entries, part 132.
5467. gbvrt133.seq - Other vertebrate sequence entries, part 133.
5468. gbvrt134.seq - Other vertebrate sequence entries, part 134.
5469. gbvrt135.seq - Other vertebrate sequence entries, part 135.
5470. gbvrt136.seq - Other vertebrate sequence entries, part 136.
5471. gbvrt137.seq - Other vertebrate sequence entries, part 137.
5472. gbvrt138.seq - Other vertebrate sequence entries, part 138.
5473. gbvrt139.seq - Other vertebrate sequence entries, part 139.
5474. gbvrt14.seq - Other vertebrate sequence entries, part 14.
5475. gbvrt140.seq - Other vertebrate sequence entries, part 140.
5476. gbvrt141.seq - Other vertebrate sequence entries, part 141.
5477. gbvrt142.seq - Other vertebrate sequence entries, part 142.
5478. gbvrt143.seq - Other vertebrate sequence entries, part 143.
5479. gbvrt144.seq - Other vertebrate sequence entries, part 144.
5480. gbvrt145.seq - Other vertebrate sequence entries, part 145.
5481. gbvrt146.seq - Other vertebrate sequence entries, part 146.
5482. gbvrt147.seq - Other vertebrate sequence entries, part 147.
5483. gbvrt148.seq - Other vertebrate sequence entries, part 148.
5484. gbvrt149.seq - Other vertebrate sequence entries, part 149.
5485. gbvrt15.seq - Other vertebrate sequence entries, part 15.
5486. gbvrt150.seq - Other vertebrate sequence entries, part 150.
5487. gbvrt151.seq - Other vertebrate sequence entries, part 151.
5488. gbvrt152.seq - Other vertebrate sequence entries, part 152.
5489. gbvrt153.seq - Other vertebrate sequence entries, part 153.
5490. gbvrt154.seq - Other vertebrate sequence entries, part 154.
5491. gbvrt155.seq - Other vertebrate sequence entries, part 155.
5492. gbvrt156.seq - Other vertebrate sequence entries, part 156.
5493. gbvrt157.seq - Other vertebrate sequence entries, part 157.
5494. gbvrt158.seq - Other vertebrate sequence entries, part 158.
5495. gbvrt159.seq - Other vertebrate sequence entries, part 159.
5496. gbvrt16.seq - Other vertebrate sequence entries, part 16.
5497. gbvrt160.seq - Other vertebrate sequence entries, part 160.
5498. gbvrt161.seq - Other vertebrate sequence entries, part 161.
5499. gbvrt162.seq - Other vertebrate sequence entries, part 162.
5500. gbvrt163.seq - Other vertebrate sequence entries, part 163.
5501. gbvrt164.seq - Other vertebrate sequence entries, part 164.
5502. gbvrt165.seq - Other vertebrate sequence entries, part 165.
5503. gbvrt166.seq - Other vertebrate sequence entries, part 166.
5504. gbvrt167.seq - Other vertebrate sequence entries, part 167.
5505. gbvrt168.seq - Other vertebrate sequence entries, part 168.
5506. gbvrt169.seq - Other vertebrate sequence entries, part 169.
5507. gbvrt17.seq - Other vertebrate sequence entries, part 17.
5508. gbvrt170.seq - Other vertebrate sequence entries, part 170.
5509. gbvrt171.seq - Other vertebrate sequence entries, part 171.
5510. gbvrt172.seq - Other vertebrate sequence entries, part 172.
5511. gbvrt173.seq - Other vertebrate sequence entries, part 173.
5512. gbvrt174.seq - Other vertebrate sequence entries, part 174.
5513. gbvrt175.seq - Other vertebrate sequence entries, part 175.
5514. gbvrt176.seq - Other vertebrate sequence entries, part 176.
5515. gbvrt177.seq - Other vertebrate sequence entries, part 177.
5516. gbvrt178.seq - Other vertebrate sequence entries, part 178.
5517. gbvrt179.seq - Other vertebrate sequence entries, part 179.
5518. gbvrt18.seq - Other vertebrate sequence entries, part 18.
5519. gbvrt180.seq - Other vertebrate sequence entries, part 180.
5520. gbvrt181.seq - Other vertebrate sequence entries, part 181.
5521. gbvrt182.seq - Other vertebrate sequence entries, part 182.
5522. gbvrt183.seq - Other vertebrate sequence entries, part 183.
5523. gbvrt184.seq - Other vertebrate sequence entries, part 184.
5524. gbvrt185.seq - Other vertebrate sequence entries, part 185.
5525. gbvrt186.seq - Other vertebrate sequence entries, part 186.
5526. gbvrt187.seq - Other vertebrate sequence entries, part 187.
5527. gbvrt188.seq - Other vertebrate sequence entries, part 188.
5528. gbvrt189.seq - Other vertebrate sequence entries, part 189.
5529. gbvrt19.seq - Other vertebrate sequence entries, part 19.
5530. gbvrt190.seq - Other vertebrate sequence entries, part 190.
5531. gbvrt191.seq - Other vertebrate sequence entries, part 191.
5532. gbvrt192.seq - Other vertebrate sequence entries, part 192.
5533. gbvrt193.seq - Other vertebrate sequence entries, part 193.
5534. gbvrt194.seq - Other vertebrate sequence entries, part 194.
5535. gbvrt195.seq - Other vertebrate sequence entries, part 195.
5536. gbvrt196.seq - Other vertebrate sequence entries, part 196.
5537. gbvrt197.seq - Other vertebrate sequence entries, part 197.
5538. gbvrt198.seq - Other vertebrate sequence entries, part 198.
5539. gbvrt199.seq - Other vertebrate sequence entries, part 199.
5540. gbvrt2.seq - Other vertebrate sequence entries, part 2.
5541. gbvrt20.seq - Other vertebrate sequence entries, part 20.
5542. gbvrt200.seq - Other vertebrate sequence entries, part 200.
5543. gbvrt201.seq - Other vertebrate sequence entries, part 201.
5544. gbvrt202.seq - Other vertebrate sequence entries, part 202.
5545. gbvrt203.seq - Other vertebrate sequence entries, part 203.
5546. gbvrt204.seq - Other vertebrate sequence entries, part 204.
5547. gbvrt205.seq - Other vertebrate sequence entries, part 205.
5548. gbvrt206.seq - Other vertebrate sequence entries, part 206.
5549. gbvrt207.seq - Other vertebrate sequence entries, part 207.
5550. gbvrt208.seq - Other vertebrate sequence entries, part 208.
5551. gbvrt209.seq - Other vertebrate sequence entries, part 209.
5552. gbvrt21.seq - Other vertebrate sequence entries, part 21.
5553. gbvrt210.seq - Other vertebrate sequence entries, part 210.
5554. gbvrt211.seq - Other vertebrate sequence entries, part 211.
5555. gbvrt212.seq - Other vertebrate sequence entries, part 212.
5556. gbvrt213.seq - Other vertebrate sequence entries, part 213.
5557. gbvrt214.seq - Other vertebrate sequence entries, part 214.
5558. gbvrt215.seq - Other vertebrate sequence entries, part 215.
5559. gbvrt216.seq - Other vertebrate sequence entries, part 216.
5560. gbvrt217.seq - Other vertebrate sequence entries, part 217.
5561. gbvrt218.seq - Other vertebrate sequence entries, part 218.
5562. gbvrt219.seq - Other vertebrate sequence entries, part 219.
5563. gbvrt22.seq - Other vertebrate sequence entries, part 22.
5564. gbvrt220.seq - Other vertebrate sequence entries, part 220.
5565. gbvrt221.seq - Other vertebrate sequence entries, part 221.
5566. gbvrt222.seq - Other vertebrate sequence entries, part 222.
5567. gbvrt223.seq - Other vertebrate sequence entries, part 223.
5568. gbvrt224.seq - Other vertebrate sequence entries, part 224.
5569. gbvrt225.seq - Other vertebrate sequence entries, part 225.
5570. gbvrt226.seq - Other vertebrate sequence entries, part 226.
5571. gbvrt227.seq - Other vertebrate sequence entries, part 227.
5572. gbvrt228.seq - Other vertebrate sequence entries, part 228.
5573. gbvrt229.seq - Other vertebrate sequence entries, part 229.
5574. gbvrt23.seq - Other vertebrate sequence entries, part 23.
5575. gbvrt230.seq - Other vertebrate sequence entries, part 230.
5576. gbvrt231.seq - Other vertebrate sequence entries, part 231.
5577. gbvrt232.seq - Other vertebrate sequence entries, part 232.
5578. gbvrt233.seq - Other vertebrate sequence entries, part 233.
5579. gbvrt234.seq - Other vertebrate sequence entries, part 234.
5580. gbvrt235.seq - Other vertebrate sequence entries, part 235.
5581. gbvrt236.seq - Other vertebrate sequence entries, part 236.
5582. gbvrt237.seq - Other vertebrate sequence entries, part 237.
5583. gbvrt238.seq - Other vertebrate sequence entries, part 238.
5584. gbvrt239.seq - Other vertebrate sequence entries, part 239.
5585. gbvrt24.seq - Other vertebrate sequence entries, part 24.
5586. gbvrt240.seq - Other vertebrate sequence entries, part 240.
5587. gbvrt241.seq - Other vertebrate sequence entries, part 241.
5588. gbvrt242.seq - Other vertebrate sequence entries, part 242.
5589. gbvrt243.seq - Other vertebrate sequence entries, part 243.
5590. gbvrt244.seq - Other vertebrate sequence entries, part 244.
5591. gbvrt245.seq - Other vertebrate sequence entries, part 245.
5592. gbvrt246.seq - Other vertebrate sequence entries, part 246.
5593. gbvrt247.seq - Other vertebrate sequence entries, part 247.
5594. gbvrt248.seq - Other vertebrate sequence entries, part 248.
5595. gbvrt249.seq - Other vertebrate sequence entries, part 249.
5596. gbvrt25.seq - Other vertebrate sequence entries, part 25.
5597. gbvrt250.seq - Other vertebrate sequence entries, part 250.
5598. gbvrt251.seq - Other vertebrate sequence entries, part 251.
5599. gbvrt252.seq - Other vertebrate sequence entries, part 252.
5600. gbvrt253.seq - Other vertebrate sequence entries, part 253.
5601. gbvrt254.seq - Other vertebrate sequence entries, part 254.
5602. gbvrt255.seq - Other vertebrate sequence entries, part 255.
5603. gbvrt256.seq - Other vertebrate sequence entries, part 256.
5604. gbvrt257.seq - Other vertebrate sequence entries, part 257.
5605. gbvrt258.seq - Other vertebrate sequence entries, part 258.
5606. gbvrt259.seq - Other vertebrate sequence entries, part 259.
5607. gbvrt26.seq - Other vertebrate sequence entries, part 26.
5608. gbvrt260.seq - Other vertebrate sequence entries, part 260.
5609. gbvrt261.seq - Other vertebrate sequence entries, part 261.
5610. gbvrt262.seq - Other vertebrate sequence entries, part 262.
5611. gbvrt263.seq - Other vertebrate sequence entries, part 263.
5612. gbvrt264.seq - Other vertebrate sequence entries, part 264.
5613. gbvrt265.seq - Other vertebrate sequence entries, part 265.
5614. gbvrt266.seq - Other vertebrate sequence entries, part 266.
5615. gbvrt267.seq - Other vertebrate sequence entries, part 267.
5616. gbvrt268.seq - Other vertebrate sequence entries, part 268.
5617. gbvrt269.seq - Other vertebrate sequence entries, part 269.
5618. gbvrt27.seq - Other vertebrate sequence entries, part 27.
5619. gbvrt270.seq - Other vertebrate sequence entries, part 270.
5620. gbvrt271.seq - Other vertebrate sequence entries, part 271.
5621. gbvrt272.seq - Other vertebrate sequence entries, part 272.
5622. gbvrt273.seq - Other vertebrate sequence entries, part 273.
5623. gbvrt274.seq - Other vertebrate sequence entries, part 274.
5624. gbvrt275.seq - Other vertebrate sequence entries, part 275.
5625. gbvrt276.seq - Other vertebrate sequence entries, part 276.
5626. gbvrt277.seq - Other vertebrate sequence entries, part 277.
5627. gbvrt278.seq - Other vertebrate sequence entries, part 278.
5628. gbvrt279.seq - Other vertebrate sequence entries, part 279.
5629. gbvrt28.seq - Other vertebrate sequence entries, part 28.
5630. gbvrt280.seq - Other vertebrate sequence entries, part 280.
5631. gbvrt281.seq - Other vertebrate sequence entries, part 281.
5632. gbvrt282.seq - Other vertebrate sequence entries, part 282.
5633. gbvrt283.seq - Other vertebrate sequence entries, part 283.
5634. gbvrt284.seq - Other vertebrate sequence entries, part 284.
5635. gbvrt285.seq - Other vertebrate sequence entries, part 285.
5636. gbvrt286.seq - Other vertebrate sequence entries, part 286.
5637. gbvrt287.seq - Other vertebrate sequence entries, part 287.
5638. gbvrt288.seq - Other vertebrate sequence entries, part 288.
5639. gbvrt289.seq - Other vertebrate sequence entries, part 289.
5640. gbvrt29.seq - Other vertebrate sequence entries, part 29.
5641. gbvrt290.seq - Other vertebrate sequence entries, part 290.
5642. gbvrt291.seq - Other vertebrate sequence entries, part 291.
5643. gbvrt292.seq - Other vertebrate sequence entries, part 292.
5644. gbvrt293.seq - Other vertebrate sequence entries, part 293.
5645. gbvrt294.seq - Other vertebrate sequence entries, part 294.
5646. gbvrt295.seq - Other vertebrate sequence entries, part 295.
5647. gbvrt296.seq - Other vertebrate sequence entries, part 296.
5648. gbvrt297.seq - Other vertebrate sequence entries, part 297.
5649. gbvrt298.seq - Other vertebrate sequence entries, part 298.
5650. gbvrt299.seq - Other vertebrate sequence entries, part 299.
5651. gbvrt3.seq - Other vertebrate sequence entries, part 3.
5652. gbvrt30.seq - Other vertebrate sequence entries, part 30.
5653. gbvrt300.seq - Other vertebrate sequence entries, part 300.
5654. gbvrt301.seq - Other vertebrate sequence entries, part 301.
5655. gbvrt302.seq - Other vertebrate sequence entries, part 302.
5656. gbvrt303.seq - Other vertebrate sequence entries, part 303.
5657. gbvrt304.seq - Other vertebrate sequence entries, part 304.
5658. gbvrt305.seq - Other vertebrate sequence entries, part 305.
5659. gbvrt306.seq - Other vertebrate sequence entries, part 306.
5660. gbvrt307.seq - Other vertebrate sequence entries, part 307.
5661. gbvrt308.seq - Other vertebrate sequence entries, part 308.
5662. gbvrt309.seq - Other vertebrate sequence entries, part 309.
5663. gbvrt31.seq - Other vertebrate sequence entries, part 31.
5664. gbvrt310.seq - Other vertebrate sequence entries, part 310.
5665. gbvrt311.seq - Other vertebrate sequence entries, part 311.
5666. gbvrt312.seq - Other vertebrate sequence entries, part 312.
5667. gbvrt313.seq - Other vertebrate sequence entries, part 313.
5668. gbvrt314.seq - Other vertebrate sequence entries, part 314.
5669. gbvrt315.seq - Other vertebrate sequence entries, part 315.
5670. gbvrt316.seq - Other vertebrate sequence entries, part 316.
5671. gbvrt317.seq - Other vertebrate sequence entries, part 317.
5672. gbvrt318.seq - Other vertebrate sequence entries, part 318.
5673. gbvrt319.seq - Other vertebrate sequence entries, part 319.
5674. gbvrt32.seq - Other vertebrate sequence entries, part 32.
5675. gbvrt320.seq - Other vertebrate sequence entries, part 320.
5676. gbvrt321.seq - Other vertebrate sequence entries, part 321.
5677. gbvrt322.seq - Other vertebrate sequence entries, part 322.
5678. gbvrt323.seq - Other vertebrate sequence entries, part 323.
5679. gbvrt324.seq - Other vertebrate sequence entries, part 324.
5680. gbvrt325.seq - Other vertebrate sequence entries, part 325.
5681. gbvrt326.seq - Other vertebrate sequence entries, part 326.
5682. gbvrt327.seq - Other vertebrate sequence entries, part 327.
5683. gbvrt328.seq - Other vertebrate sequence entries, part 328.
5684. gbvrt329.seq - Other vertebrate sequence entries, part 329.
5685. gbvrt33.seq - Other vertebrate sequence entries, part 33.
5686. gbvrt330.seq - Other vertebrate sequence entries, part 330.
5687. gbvrt331.seq - Other vertebrate sequence entries, part 331.
5688. gbvrt332.seq - Other vertebrate sequence entries, part 332.
5689. gbvrt333.seq - Other vertebrate sequence entries, part 333.
5690. gbvrt334.seq - Other vertebrate sequence entries, part 334.
5691. gbvrt335.seq - Other vertebrate sequence entries, part 335.
5692. gbvrt336.seq - Other vertebrate sequence entries, part 336.
5693. gbvrt337.seq - Other vertebrate sequence entries, part 337.
5694. gbvrt338.seq - Other vertebrate sequence entries, part 338.
5695. gbvrt339.seq - Other vertebrate sequence entries, part 339.
5696. gbvrt34.seq - Other vertebrate sequence entries, part 34.
5697. gbvrt340.seq - Other vertebrate sequence entries, part 340.
5698. gbvrt341.seq - Other vertebrate sequence entries, part 341.
5699. gbvrt342.seq - Other vertebrate sequence entries, part 342.
5700. gbvrt343.seq - Other vertebrate sequence entries, part 343.
5701. gbvrt344.seq - Other vertebrate sequence entries, part 344.
5702. gbvrt345.seq - Other vertebrate sequence entries, part 345.
5703. gbvrt346.seq - Other vertebrate sequence entries, part 346.
5704. gbvrt347.seq - Other vertebrate sequence entries, part 347.
5705. gbvrt348.seq - Other vertebrate sequence entries, part 348.
5706. gbvrt349.seq - Other vertebrate sequence entries, part 349.
5707. gbvrt35.seq - Other vertebrate sequence entries, part 35.
5708. gbvrt350.seq - Other vertebrate sequence entries, part 350.
5709. gbvrt351.seq - Other vertebrate sequence entries, part 351.
5710. gbvrt352.seq - Other vertebrate sequence entries, part 352.
5711. gbvrt353.seq - Other vertebrate sequence entries, part 353.
5712. gbvrt354.seq - Other vertebrate sequence entries, part 354.
5713. gbvrt355.seq - Other vertebrate sequence entries, part 355.
5714. gbvrt356.seq - Other vertebrate sequence entries, part 356.
5715. gbvrt357.seq - Other vertebrate sequence entries, part 357.
5716. gbvrt358.seq - Other vertebrate sequence entries, part 358.
5717. gbvrt359.seq - Other vertebrate sequence entries, part 359.
5718. gbvrt36.seq - Other vertebrate sequence entries, part 36.
5719. gbvrt360.seq - Other vertebrate sequence entries, part 360.
5720. gbvrt361.seq - Other vertebrate sequence entries, part 361.
5721. gbvrt362.seq - Other vertebrate sequence entries, part 362.
5722. gbvrt363.seq - Other vertebrate sequence entries, part 363.
5723. gbvrt364.seq - Other vertebrate sequence entries, part 364.
5724. gbvrt365.seq - Other vertebrate sequence entries, part 365.
5725. gbvrt366.seq - Other vertebrate sequence entries, part 366.
5726. gbvrt367.seq - Other vertebrate sequence entries, part 367.
5727. gbvrt368.seq - Other vertebrate sequence entries, part 368.
5728. gbvrt369.seq - Other vertebrate sequence entries, part 369.
5729. gbvrt37.seq - Other vertebrate sequence entries, part 37.
5730. gbvrt38.seq - Other vertebrate sequence entries, part 38.
5731. gbvrt39.seq - Other vertebrate sequence entries, part 39.
5732. gbvrt4.seq - Other vertebrate sequence entries, part 4.
5733. gbvrt40.seq - Other vertebrate sequence entries, part 40.
5734. gbvrt41.seq - Other vertebrate sequence entries, part 41.
5735. gbvrt42.seq - Other vertebrate sequence entries, part 42.
5736. gbvrt43.seq - Other vertebrate sequence entries, part 43.
5737. gbvrt44.seq - Other vertebrate sequence entries, part 44.
5738. gbvrt45.seq - Other vertebrate sequence entries, part 45.
5739. gbvrt46.seq - Other vertebrate sequence entries, part 46.
5740. gbvrt47.seq - Other vertebrate sequence entries, part 47.
5741. gbvrt48.seq - Other vertebrate sequence entries, part 48.
5742. gbvrt49.seq - Other vertebrate sequence entries, part 49.
5743. gbvrt5.seq - Other vertebrate sequence entries, part 5.
5744. gbvrt50.seq - Other vertebrate sequence entries, part 50.
5745. gbvrt51.seq - Other vertebrate sequence entries, part 51.
5746. gbvrt52.seq - Other vertebrate sequence entries, part 52.
5747. gbvrt53.seq - Other vertebrate sequence entries, part 53.
5748. gbvrt54.seq - Other vertebrate sequence entries, part 54.
5749. gbvrt55.seq - Other vertebrate sequence entries, part 55.
5750. gbvrt56.seq - Other vertebrate sequence entries, part 56.
5751. gbvrt57.seq - Other vertebrate sequence entries, part 57.
5752. gbvrt58.seq - Other vertebrate sequence entries, part 58.
5753. gbvrt59.seq - Other vertebrate sequence entries, part 59.
5754. gbvrt6.seq - Other vertebrate sequence entries, part 6.
5755. gbvrt60.seq - Other vertebrate sequence entries, part 60.
5756. gbvrt61.seq - Other vertebrate sequence entries, part 61.
5757. gbvrt62.seq - Other vertebrate sequence entries, part 62.
5758. gbvrt63.seq - Other vertebrate sequence entries, part 63.
5759. gbvrt64.seq - Other vertebrate sequence entries, part 64.
5760. gbvrt65.seq - Other vertebrate sequence entries, part 65.
5761. gbvrt66.seq - Other vertebrate sequence entries, part 66.
5762. gbvrt67.seq - Other vertebrate sequence entries, part 67.
5763. gbvrt68.seq - Other vertebrate sequence entries, part 68.
5764. gbvrt69.seq - Other vertebrate sequence entries, part 69.
5765. gbvrt7.seq - Other vertebrate sequence entries, part 7.
5766. gbvrt70.seq - Other vertebrate sequence entries, part 70.
5767. gbvrt71.seq - Other vertebrate sequence entries, part 71.
5768. gbvrt72.seq - Other vertebrate sequence entries, part 72.
5769. gbvrt73.seq - Other vertebrate sequence entries, part 73.
5770. gbvrt74.seq - Other vertebrate sequence entries, part 74.
5771. gbvrt75.seq - Other vertebrate sequence entries, part 75.
5772. gbvrt76.seq - Other vertebrate sequence entries, part 76.
5773. gbvrt77.seq - Other vertebrate sequence entries, part 77.
5774. gbvrt78.seq - Other vertebrate sequence entries, part 78.
5775. gbvrt79.seq - Other vertebrate sequence entries, part 79.
5776. gbvrt8.seq - Other vertebrate sequence entries, part 8.
5777. gbvrt80.seq - Other vertebrate sequence entries, part 80.
5778. gbvrt81.seq - Other vertebrate sequence entries, part 81.
5779. gbvrt82.seq - Other vertebrate sequence entries, part 82.
5780. gbvrt83.seq - Other vertebrate sequence entries, part 83.
5781. gbvrt84.seq - Other vertebrate sequence entries, part 84.
5782. gbvrt85.seq - Other vertebrate sequence entries, part 85.
5783. gbvrt86.seq - Other vertebrate sequence entries, part 86.
5784. gbvrt87.seq - Other vertebrate sequence entries, part 87.
5785. gbvrt88.seq - Other vertebrate sequence entries, part 88.
5786. gbvrt89.seq - Other vertebrate sequence entries, part 89.
5787. gbvrt9.seq - Other vertebrate sequence entries, part 9.
5788. gbvrt90.seq - Other vertebrate sequence entries, part 90.
5789. gbvrt91.seq - Other vertebrate sequence entries, part 91.
5790. gbvrt92.seq - Other vertebrate sequence entries, part 92.
5791. gbvrt93.seq - Other vertebrate sequence entries, part 93.
5792. gbvrt94.seq - Other vertebrate sequence entries, part 94.
5793. gbvrt95.seq - Other vertebrate sequence entries, part 95.
5794. gbvrt96.seq - Other vertebrate sequence entries, part 96.
5795. gbvrt97.seq - Other vertebrate sequence entries, part 97.
5796. gbvrt98.seq - Other vertebrate sequence entries, part 98.
5797. gbvrt99.seq - Other vertebrate sequence entries, part 99.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 265.0 flatfiles require roughly 7887 GB,
including the sequence files and the *.txt files.
The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1488592971 gbbct1.seq
1495472321 gbbct10.seq
1489892531 gbbct100.seq
1485866413 gbbct101.seq
1495787814 gbbct102.seq
1499789354 gbbct103.seq
1489200081 gbbct104.seq
1495300205 gbbct105.seq
1499630537 gbbct106.seq
1487555338 gbbct107.seq
1497990875 gbbct108.seq
1499000032 gbbct109.seq
1496136870 gbbct11.seq
1496053858 gbbct110.seq
1497372081 gbbct111.seq
1498047325 gbbct112.seq
1499186026 gbbct113.seq
1499902997 gbbct114.seq
1495892418 gbbct115.seq
1496502352 gbbct116.seq
1494718386 gbbct117.seq
1494814678 gbbct118.seq
1490810057 gbbct119.seq
1494311825 gbbct12.seq
1498317583 gbbct120.seq
1499934197 gbbct121.seq
1486435025 gbbct122.seq
1489165323 gbbct123.seq
1496338762 gbbct124.seq
1497773432 gbbct125.seq
1496786510 gbbct126.seq
1495983071 gbbct127.seq
1494463659 gbbct128.seq
1496120158 gbbct129.seq
1499875891 gbbct13.seq
1490438767 gbbct130.seq
1493143307 gbbct131.seq
1495210340 gbbct132.seq
1498760673 gbbct133.seq
1496079866 gbbct134.seq
1493401224 gbbct135.seq
1499322801 gbbct136.seq
1490922650 gbbct137.seq
1491668876 gbbct138.seq
1496265127 gbbct139.seq
1494501505 gbbct14.seq
1497827759 gbbct140.seq
1495004497 gbbct141.seq
1493076400 gbbct142.seq
1498896816 gbbct143.seq
1494547404 gbbct144.seq
1493489005 gbbct145.seq
1499510503 gbbct146.seq
1493802342 gbbct147.seq
1493254610 gbbct148.seq
1491504824 gbbct149.seq
1496554047 gbbct15.seq
1495868057 gbbct150.seq
1495610757 gbbct151.seq
1499755820 gbbct152.seq
1497525876 gbbct153.seq
1487095898 gbbct154.seq
1498279048 gbbct155.seq
1499727209 gbbct156.seq
1498965358 gbbct157.seq
1498184490 gbbct158.seq
1495345811 gbbct159.seq
1482483724 gbbct16.seq
1497371606 gbbct160.seq
1497487458 gbbct161.seq
1494823622 gbbct162.seq
1491841011 gbbct163.seq
1495804004 gbbct164.seq
1495304341 gbbct165.seq
1494787201 gbbct166.seq
1482373159 gbbct167.seq
1493628269 gbbct168.seq
1495184353 gbbct169.seq
1499803648 gbbct17.seq
1495445517 gbbct170.seq
1495103884 gbbct171.seq
1493134771 gbbct172.seq
1488382713 gbbct173.seq
1488255306 gbbct174.seq
1499659045 gbbct175.seq
1495897321 gbbct176.seq
1495364069 gbbct177.seq
1498675172 gbbct178.seq
1489118463 gbbct179.seq
1481592783 gbbct18.seq
1491882557 gbbct180.seq
1489156261 gbbct181.seq
1499551662 gbbct182.seq
1492117071 gbbct183.seq
1495414400 gbbct184.seq
1498319480 gbbct185.seq
1498672545 gbbct186.seq
1497746733 gbbct187.seq
1492265112 gbbct188.seq
1496097283 gbbct189.seq
1499900186 gbbct19.seq
1498549276 gbbct190.seq
1496807299 gbbct191.seq
1496606042 gbbct192.seq
1489797171 gbbct193.seq
1495194348 gbbct194.seq
1493560943 gbbct195.seq
1490176090 gbbct196.seq
1499452111 gbbct197.seq
1497763505 gbbct198.seq
1499723745 gbbct199.seq
1494999877 gbbct2.seq
1498861252 gbbct20.seq
1499790317 gbbct200.seq
1495128013 gbbct201.seq
1493040080 gbbct202.seq
1494794362 gbbct203.seq
1498136462 gbbct204.seq
1484772211 gbbct205.seq
1499888624 gbbct206.seq
1493835325 gbbct207.seq
1499978158 gbbct208.seq
1496922208 gbbct209.seq
1497372438 gbbct21.seq
1490255109 gbbct210.seq
1490458909 gbbct211.seq
1491503414 gbbct212.seq
1492910187 gbbct213.seq
1495967712 gbbct214.seq
1499685471 gbbct215.seq
1499938413 gbbct216.seq
1492949018 gbbct217.seq
1490977088 gbbct218.seq
1489834126 gbbct219.seq
1493574138 gbbct22.seq
1499994894 gbbct220.seq
1495734097 gbbct221.seq
1495071254 gbbct222.seq
1495909582 gbbct223.seq
1494631040 gbbct224.seq
1491662408 gbbct225.seq
1496859862 gbbct226.seq
1499749319 gbbct227.seq
1491802354 gbbct228.seq
1496261572 gbbct229.seq
1497124076 gbbct23.seq
1497868543 gbbct230.seq
1494013936 gbbct231.seq
1496429639 gbbct232.seq
1495408191 gbbct233.seq
1496088326 gbbct234.seq
1494499533 gbbct235.seq
1495482815 gbbct236.seq
1494296134 gbbct237.seq
1491315132 gbbct238.seq
1499517319 gbbct239.seq
1498592959 gbbct24.seq
1487276372 gbbct240.seq
1499879013 gbbct241.seq
1495632198 gbbct242.seq
1495259852 gbbct243.seq
1499462330 gbbct244.seq
1493467528 gbbct245.seq
1491713251 gbbct246.seq
1491236075 gbbct247.seq
1498659739 gbbct248.seq
1499551548 gbbct249.seq
1495917700 gbbct25.seq
1488357176 gbbct250.seq
1488729464 gbbct251.seq
1494332278 gbbct252.seq
1491260119 gbbct253.seq
1491456274 gbbct254.seq
1488203499 gbbct255.seq
1495674073 gbbct256.seq
1489986447 gbbct257.seq
1479907979 gbbct258.seq
1489183169 gbbct259.seq
1493096759 gbbct26.seq
1483124092 gbbct260.seq
1484848628 gbbct261.seq
1489062245 gbbct262.seq
1487234954 gbbct263.seq
1486663103 gbbct264.seq
1498107891 gbbct265.seq
1488661534 gbbct266.seq
1484761215 gbbct267.seq
1497487805 gbbct268.seq
1490768365 gbbct269.seq
1494056100 gbbct27.seq
1494624978 gbbct270.seq
1491204047 gbbct271.seq
1489890035 gbbct272.seq
1495988912 gbbct273.seq
1496975931 gbbct274.seq
1499948849 gbbct275.seq
1498323391 gbbct276.seq
1488573124 gbbct277.seq
1490675562 gbbct278.seq
1496600303 gbbct279.seq
1499823036 gbbct28.seq
1499105380 gbbct280.seq
1489773582 gbbct281.seq
1494899588 gbbct282.seq
1488974176 gbbct283.seq
1492819608 gbbct284.seq
1498463951 gbbct285.seq
1491066859 gbbct286.seq
1495510252 gbbct287.seq
1498685532 gbbct288.seq
1496851630 gbbct289.seq
1496478972 gbbct29.seq
1496345393 gbbct290.seq
1497649197 gbbct291.seq
1479746440 gbbct292.seq
1498663573 gbbct293.seq
1499919643 gbbct294.seq
1489652017 gbbct295.seq
1488060550 gbbct296.seq
1495690629 gbbct297.seq
1494849481 gbbct298.seq
1498418201 gbbct299.seq
1495729708 gbbct3.seq
1497841114 gbbct30.seq
1498105701 gbbct300.seq
1493758567 gbbct301.seq
1499572568 gbbct302.seq
1485461114 gbbct303.seq
1498861325 gbbct304.seq
1492437864 gbbct305.seq
1499911870 gbbct306.seq
1496385163 gbbct307.seq
1488701799 gbbct308.seq
1493880384 gbbct309.seq
1490660062 gbbct31.seq
1489203940 gbbct310.seq
1499479041 gbbct311.seq
1493950556 gbbct312.seq
1495310207 gbbct313.seq
1496159125 gbbct314.seq
1488242089 gbbct315.seq
1499993766 gbbct316.seq
1491601894 gbbct317.seq
1499367406 gbbct318.seq
1493006362 gbbct319.seq
1493818282 gbbct32.seq
1494108828 gbbct320.seq
1499506816 gbbct321.seq
1495075699 gbbct322.seq
1487248306 gbbct323.seq
1486764484 gbbct324.seq
1499844092 gbbct325.seq
1488638067 gbbct326.seq
1491352721 gbbct327.seq
1499991789 gbbct328.seq
1497033601 gbbct329.seq
1489089652 gbbct33.seq
1497096696 gbbct330.seq
1491162261 gbbct331.seq
1497840383 gbbct332.seq
1493597492 gbbct333.seq
1496570068 gbbct334.seq
1498702684 gbbct335.seq
1498579814 gbbct336.seq
1495928899 gbbct337.seq
1497023026 gbbct338.seq
1498860785 gbbct339.seq
1491409838 gbbct34.seq
1497723083 gbbct340.seq
1492422204 gbbct341.seq
1495329496 gbbct342.seq
1499751943 gbbct343.seq
1493461716 gbbct344.seq
1494362830 gbbct345.seq
1498601608 gbbct346.seq
1499881952 gbbct347.seq
1498778481 gbbct348.seq
1497521383 gbbct349.seq
1487106634 gbbct35.seq
1480584886 gbbct350.seq
1490960828 gbbct351.seq
1493632655 gbbct352.seq
1494456921 gbbct353.seq
1497535919 gbbct354.seq
1487278303 gbbct355.seq
1495476214 gbbct356.seq
1491413136 gbbct357.seq
1499332136 gbbct358.seq
1490044933 gbbct359.seq
1485395628 gbbct36.seq
1497515172 gbbct360.seq
1498863902 gbbct361.seq
1483339077 gbbct362.seq
1499929417 gbbct363.seq
1497960039 gbbct364.seq
1489175480 gbbct365.seq
1491231049 gbbct366.seq
1490191525 gbbct367.seq
1491978450 gbbct368.seq
1493479504 gbbct369.seq
1496202264 gbbct37.seq
1490129658 gbbct370.seq
1489181880 gbbct371.seq
1490640767 gbbct372.seq
1496522417 gbbct373.seq
1496690080 gbbct374.seq
1490359200 gbbct375.seq
1495274308 gbbct376.seq
1488672453 gbbct377.seq
1497591226 gbbct378.seq
1498996634 gbbct379.seq
1498997814 gbbct38.seq
1489422246 gbbct380.seq
1498715202 gbbct381.seq
1498515494 gbbct382.seq
1490465122 gbbct383.seq
1494176979 gbbct384.seq
1495390479 gbbct385.seq
1484205722 gbbct386.seq
1496729782 gbbct387.seq
1488980763 gbbct388.seq
1490156135 gbbct389.seq
1492118111 gbbct39.seq
1486193194 gbbct390.seq
1498412308 gbbct391.seq
1495869766 gbbct392.seq
1491616811 gbbct393.seq
1497685655 gbbct394.seq
1496367372 gbbct395.seq
1496782765 gbbct396.seq
1495152248 gbbct397.seq
1496336980 gbbct398.seq
1499999733 gbbct399.seq
1491951700 gbbct4.seq
1494022954 gbbct40.seq
1499998759 gbbct400.seq
1499992527 gbbct401.seq
1489656671 gbbct402.seq
1491054904 gbbct403.seq
1496895879 gbbct404.seq
1489994146 gbbct405.seq
1489683328 gbbct406.seq
1497038617 gbbct407.seq
1496763926 gbbct408.seq
1496032392 gbbct409.seq
1498346983 gbbct41.seq
1490869419 gbbct410.seq
1497683930 gbbct411.seq
1498870895 gbbct412.seq
1499675845 gbbct413.seq
1499940769 gbbct414.seq
1499996880 gbbct415.seq
1489668734 gbbct416.seq
1499989597 gbbct417.seq
1499107725 gbbct418.seq
1487426923 gbbct419.seq
1489254232 gbbct42.seq
1491280953 gbbct420.seq
1496217151 gbbct421.seq
1498139552 gbbct422.seq
1498394250 gbbct423.seq
1496378172 gbbct424.seq
1499655334 gbbct425.seq
1499920604 gbbct426.seq
1498920545 gbbct427.seq
1062267014 gbbct428.seq
1498940120 gbbct43.seq
1491897217 gbbct44.seq
1492190352 gbbct45.seq
1499776001 gbbct46.seq
1490322661 gbbct47.seq
1499732656 gbbct48.seq
1496770929 gbbct49.seq
1493309403 gbbct5.seq
1497190751 gbbct50.seq
1489140581 gbbct51.seq
1498877833 gbbct52.seq
1487768614 gbbct53.seq
1491163342 gbbct54.seq
1495932550 gbbct55.seq
1499465571 gbbct56.seq
1495377590 gbbct57.seq
1494284739 gbbct58.seq
1490579163 gbbct59.seq
1491762260 gbbct6.seq
1495774169 gbbct60.seq
1499511642 gbbct61.seq
1491144933 gbbct62.seq
1496992777 gbbct63.seq
1498685285 gbbct64.seq
1488281544 gbbct65.seq
1496645828 gbbct66.seq
1494903111 gbbct67.seq
1495927036 gbbct68.seq
1499085581 gbbct69.seq
1499267435 gbbct7.seq
1496789607 gbbct70.seq
1497163754 gbbct71.seq
1497705293 gbbct72.seq
1492345041 gbbct73.seq
1496991700 gbbct74.seq
1499923725 gbbct75.seq
1490654105 gbbct76.seq
1495156745 gbbct77.seq
1490824128 gbbct78.seq
1498888187 gbbct79.seq
1483659757 gbbct8.seq
1498899637 gbbct80.seq
1490186675 gbbct81.seq
1491904703 gbbct82.seq
1493857674 gbbct83.seq
1490814569 gbbct84.seq
1494848180 gbbct85.seq
1495961224 gbbct86.seq
1496787623 gbbct87.seq
1495529550 gbbct88.seq
1493838076 gbbct89.seq
1495263162 gbbct9.seq
1491088321 gbbct90.seq
1494432099 gbbct91.seq
1496649208 gbbct92.seq
1494180620 gbbct93.seq
1499802917 gbbct94.seq
1499667853 gbbct95.seq
1493469593 gbbct96.seq
1494966643 gbbct97.seq
1498958158 gbbct98.seq
1491556682 gbbct99.seq
13339690 gbchg.txt
1499996382 gbcon1.seq
1499999702 gbcon10.seq
1499996081 gbcon11.seq
1499998416 gbcon12.seq
1499999728 gbcon13.seq
1499995193 gbcon14.seq
1499999353 gbcon15.seq
1499999133 gbcon16.seq
1499995671 gbcon17.seq
1499999361 gbcon18.seq
1499996098 gbcon19.seq
1496681544 gbcon2.seq
1499991943 gbcon20.seq
1499996471 gbcon21.seq
1499998220 gbcon22.seq
1499914769 gbcon23.seq
1499959886 gbcon24.seq
1499995559 gbcon25.seq
1499999413 gbcon26.seq
1495402102 gbcon27.seq
1499990841 gbcon28.seq
1493969786 gbcon29.seq
1499644437 gbcon3.seq
1499982399 gbcon30.seq
1499984579 gbcon31.seq
1499503401 gbcon32.seq
1499999455 gbcon33.seq
1499642033 gbcon34.seq
1498392940 gbcon35.seq
1499983250 gbcon36.seq
1499997768 gbcon37.seq
1499998734 gbcon38.seq
1499999038 gbcon39.seq
1498888854 gbcon4.seq
1499995851 gbcon40.seq
1499996110 gbcon41.seq
1499998677 gbcon42.seq
1499999510 gbcon43.seq
1499994374 gbcon44.seq
1499994492 gbcon45.seq
1499844899 gbcon46.seq
1500000251 gbcon47.seq
1499990050 gbcon48.seq
1499292039 gbcon49.seq
1495900935 gbcon5.seq
1499998306 gbcon50.seq
1499998770 gbcon51.seq
1499996042 gbcon52.seq
1499997445 gbcon53.seq
1499998904 gbcon54.seq
1499998759 gbcon55.seq
1499999017 gbcon56.seq
1499999402 gbcon57.seq
1499985618 gbcon58.seq
1499997913 gbcon59.seq
1499065571 gbcon6.seq
1499834438 gbcon60.seq
1499888225 gbcon61.seq
1499996124 gbcon62.seq
1499708781 gbcon63.seq
1499832657 gbcon64.seq
1499997790 gbcon65.seq
1499985614 gbcon66.seq
1498641600 gbcon67.seq
975413058 gbcon68.seq
1500000245 gbcon7.seq
1499999463 gbcon8.seq
1499799393 gbcon9.seq
355247 gbdel.txt
1491411159 gbenv1.seq
1499999162 gbenv10.seq
1499999414 gbenv11.seq
1499999905 gbenv12.seq
1499997986 gbenv13.seq
1500000034 gbenv14.seq
1499998078 gbenv15.seq
1499999332 gbenv16.seq
1499999879 gbenv17.seq
1499999075 gbenv18.seq
1499999561 gbenv19.seq
1492677676 gbenv2.seq
1499999433 gbenv20.seq
1499999159 gbenv21.seq
1499982403 gbenv22.seq
1499996872 gbenv23.seq
1494818377 gbenv24.seq
1496607747 gbenv25.seq
1495547115 gbenv26.seq
1499584621 gbenv27.seq
1497514230 gbenv28.seq
1497296668 gbenv29.seq
1492010117 gbenv3.seq
769014221 gbenv30.seq
1498210627 gbenv4.seq
1499999940 gbenv5.seq
1499998975 gbenv6.seq
1499998395 gbenv7.seq
1499999525 gbenv8.seq
1499998494 gbenv9.seq
1500000091 gbest1.seq
1499997366 gbest10.seq
1499999669 gbest100.seq
1499999394 gbest101.seq
1499999174 gbest102.seq
1499998028 gbest103.seq
1499999252 gbest104.seq
1499998218 gbest105.seq
1499998058 gbest106.seq
1499999954 gbest107.seq
1499996679 gbest108.seq
1499999651 gbest109.seq
1499999224 gbest11.seq
1499998775 gbest110.seq
1499996815 gbest111.seq
1499997055 gbest112.seq
1499998005 gbest113.seq
1499999212 gbest114.seq
1499998179 gbest115.seq
1499999167 gbest116.seq
1499999876 gbest117.seq
1499999325 gbest118.seq
1499997316 gbest119.seq
1499999309 gbest12.seq
1499999505 gbest120.seq
1499999062 gbest121.seq
1499999804 gbest122.seq
1499998546 gbest123.seq
1499997868 gbest124.seq
1499995981 gbest125.seq
1499997862 gbest126.seq
1499997342 gbest127.seq
1499999731 gbest128.seq
1499997863 gbest129.seq
1499998217 gbest13.seq
1499998823 gbest130.seq
1499999409 gbest131.seq
1499999076 gbest132.seq
1499998212 gbest133.seq
1499998968 gbest134.seq
1499998723 gbest135.seq
1499997171 gbest136.seq
1499997057 gbest137.seq
1499997924 gbest138.seq
1499994291 gbest139.seq
1499999060 gbest14.seq
1500000113 gbest140.seq
1499998774 gbest141.seq
1500000075 gbest142.seq
1499999466 gbest143.seq
1499999397 gbest144.seq
1499997692 gbest145.seq
1499999911 gbest146.seq
1499998163 gbest147.seq
1499998961 gbest148.seq
1499999839 gbest149.seq
1499998706 gbest15.seq
1499998331 gbest150.seq
1499999554 gbest151.seq
1499998610 gbest152.seq
1499997745 gbest153.seq
1499998933 gbest154.seq
1499998231 gbest155.seq
1499999434 gbest156.seq
1499996853 gbest157.seq
1499998682 gbest158.seq
1499997587 gbest159.seq
1499998129 gbest16.seq
1499999269 gbest160.seq
1499999670 gbest161.seq
1499998372 gbest162.seq
1499998893 gbest163.seq
523242216 gbest164.seq
1499999690 gbest17.seq
1499999729 gbest18.seq
1499996645 gbest19.seq
1499999413 gbest2.seq
1499998235 gbest20.seq
1499997243 gbest21.seq
1499998752 gbest22.seq
1499999311 gbest23.seq
1499998816 gbest24.seq
1499996369 gbest25.seq
1499996253 gbest26.seq
1499997387 gbest27.seq
1500000153 gbest28.seq
1499999688 gbest29.seq
1499998749 gbest3.seq
1499997635 gbest30.seq
1499996391 gbest31.seq
1499999150 gbest32.seq
1499999353 gbest33.seq
1499998947 gbest34.seq
1499998565 gbest35.seq
1499996331 gbest36.seq
1499994963 gbest37.seq
1499996565 gbest38.seq
1499998235 gbest39.seq
1499999796 gbest4.seq
1499997990 gbest40.seq
1499997286 gbest41.seq
1499998826 gbest42.seq
1500000058 gbest43.seq
1499999729 gbest44.seq
1499998751 gbest45.seq
1499999452 gbest46.seq
1499997770 gbest47.seq
1499998445 gbest48.seq
1499999421 gbest49.seq
1499997216 gbest5.seq
1499998537 gbest50.seq
1499999100 gbest51.seq
1499996948 gbest52.seq
1499999404 gbest53.seq
1499997993 gbest54.seq
1499997233 gbest55.seq
1499999686 gbest56.seq
1499999013 gbest57.seq
1499998914 gbest58.seq
1499999837 gbest59.seq
1499996987 gbest6.seq
1499997413 gbest60.seq
1499999093 gbest61.seq
1499997535 gbest62.seq
1499996941 gbest63.seq
1499998877 gbest64.seq
1499992589 gbest65.seq
1500000074 gbest66.seq
1499997729 gbest67.seq
1499997823 gbest68.seq
1499999160 gbest69.seq
1499999247 gbest7.seq
1499999688 gbest70.seq
1499997841 gbest71.seq
1499998171 gbest72.seq
1499998840 gbest73.seq
1499998182 gbest74.seq
1499997856 gbest75.seq
1499998352 gbest76.seq
1500000175 gbest77.seq
1499998276 gbest78.seq
1499999275 gbest79.seq
1499996736 gbest8.seq
1500000105 gbest80.seq
1499999095 gbest81.seq
1499999270 gbest82.seq
1499997170 gbest83.seq
1499998651 gbest84.seq
1499997543 gbest85.seq
1499999886 gbest86.seq
1500000257 gbest87.seq
1499997862 gbest88.seq
1499996821 gbest89.seq
1499999604 gbest9.seq
1500000194 gbest90.seq
1499999627 gbest91.seq
1499997844 gbest92.seq
1499998767 gbest93.seq
1499997809 gbest94.seq
1499998950 gbest95.seq
1499999475 gbest96.seq
1500000005 gbest97.seq
1499999402 gbest98.seq
1499998749 gbest99.seq
1499999893 gbgss1.seq
1499998511 gbgss10.seq
1499999568 gbgss11.seq
1499998818 gbgss12.seq
1499999883 gbgss13.seq
1499998269 gbgss14.seq
1499998459 gbgss15.seq
1500000237 gbgss16.seq
1499997776 gbgss17.seq
1499998560 gbgss18.seq
1499999998 gbgss19.seq
1499997825 gbgss2.seq
1500000044 gbgss20.seq
1499998104 gbgss21.seq
1499997068 gbgss22.seq
1499999725 gbgss23.seq
1499998729 gbgss24.seq
1499999493 gbgss25.seq
1499998431 gbgss26.seq
1499999661 gbgss27.seq
1499998373 gbgss28.seq
1499997959 gbgss29.seq
1499997910 gbgss3.seq
1499997863 gbgss30.seq
1499998246 gbgss31.seq
1499997366 gbgss32.seq
1499997630 gbgss33.seq
1499998304 gbgss34.seq
1499998850 gbgss35.seq
1499999698 gbgss36.seq
1499998783 gbgss37.seq
1499999628 gbgss38.seq
1499999407 gbgss39.seq
1499999260 gbgss4.seq
1499997914 gbgss40.seq
1500000023 gbgss41.seq
1499998339 gbgss42.seq
1499996728 gbgss43.seq
1499998719 gbgss44.seq
1499999664 gbgss45.seq
1499997017 gbgss46.seq
1499999591 gbgss47.seq
1499999531 gbgss48.seq
1499999400 gbgss49.seq
1500000208 gbgss5.seq
1499999169 gbgss50.seq
1499998816 gbgss51.seq
1499998950 gbgss52.seq
1499998428 gbgss53.seq
1499999313 gbgss54.seq
1499999996 gbgss55.seq
1499997362 gbgss56.seq
1499997924 gbgss57.seq
1499999680 gbgss58.seq
1499997785 gbgss59.seq
1499999706 gbgss6.seq
1499999034 gbgss60.seq
1499999151 gbgss61.seq
1499999326 gbgss62.seq
1499998612 gbgss63.seq
1499998154 gbgss64.seq
1499999236 gbgss65.seq
1499999650 gbgss66.seq
1499999288 gbgss67.seq
1500000117 gbgss68.seq
1499998238 gbgss69.seq
1499997198 gbgss7.seq
1499999675 gbgss70.seq
1499998182 gbgss71.seq
1499998158 gbgss72.seq
1499996619 gbgss73.seq
1499998657 gbgss74.seq
1499997724 gbgss75.seq
1499998720 gbgss76.seq
1499998913 gbgss77.seq
1499998815 gbgss78.seq
430247914 gbgss79.seq
1499997889 gbgss8.seq
1499999134 gbgss9.seq
1499996974 gbhtc1.seq
1499996282 gbhtc2.seq
487234869 gbhtc3.seq
1499970679 gbhtg1.seq
1499829019 gbhtg10.seq
1499872343 gbhtg11.seq
1499884544 gbhtg12.seq
1499861752 gbhtg13.seq
1499897929 gbhtg14.seq
1499835864 gbhtg15.seq
1499690417 gbhtg16.seq
1499782068 gbhtg17.seq
1499852826 gbhtg18.seq
1499876752 gbhtg19.seq
1499830411 gbhtg2.seq
1499945647 gbhtg20.seq
1499944231 gbhtg21.seq
1499865306 gbhtg22.seq
1499789537 gbhtg23.seq
1499904773 gbhtg24.seq
650086903 gbhtg25.seq
1499902231 gbhtg3.seq
1499865254 gbhtg4.seq
1499916236 gbhtg5.seq
1499781411 gbhtg6.seq
1499713912 gbhtg7.seq
1499983844 gbhtg8.seq
1499942611 gbhtg9.seq
1499998067 gbinv1.seq
1499923885 gbinv10.seq
1491336414 gbinv100.seq
1427091243 gbinv1000.se
1454159318 gbinv1001.se
1499087047 gbinv1002.se
1475844011 gbinv1003.se
1428300466 gbinv1004.se
1399959631 gbinv1005.se
1458382254 gbinv1006.se
1497615482 gbinv1007.se
1484927473 gbinv1008.se
1471799932 gbinv1009.se
1495591944 gbinv101.seq
1487838911 gbinv1010.se
1487027578 gbinv1011.se
1481099730 gbinv1012.se
1497638538 gbinv1013.se
1483827594 gbinv1014.se
1483821237 gbinv1015.se
1489831337 gbinv1016.se
1467881005 gbinv1017.se
1479727557 gbinv1018.se
1488290850 gbinv1019.se
1481008358 gbinv102.seq
1467268776 gbinv1020.se
1492207021 gbinv1021.se
1363961305 gbinv1022.se
1320201313 gbinv1023.se
1480297535 gbinv1024.se
1440549582 gbinv1025.se
1359602883 gbinv1026.se
1426066925 gbinv1027.se
1483939418 gbinv1028.se
1415029251 gbinv1029.se
1491256342 gbinv103.seq
1486566603 gbinv1030.se
1477057418 gbinv1031.se
1476635933 gbinv1032.se
1499307582 gbinv1033.se
1496002548 gbinv1034.se
1479641483 gbinv1035.se
1459647517 gbinv1036.se
1494702984 gbinv1037.se
1487949565 gbinv1038.se
1497800590 gbinv1039.se
1499683325 gbinv104.seq
1461242418 gbinv1040.se
1489870431 gbinv1041.se
1495884092 gbinv1042.se
1497540413 gbinv1043.se
1486197654 gbinv1044.se
1326922414 gbinv1045.se
1401752460 gbinv1046.se
1415394702 gbinv1047.se
1483656229 gbinv1048.se
1396699373 gbinv1049.se
1465556601 gbinv105.seq
1488975706 gbinv1050.se
1372993989 gbinv1051.se
1421687738 gbinv1052.se
1486289482 gbinv1053.se
1493511949 gbinv1054.se
1408375747 gbinv1055.se
1497759371 gbinv1056.se
1496282789 gbinv1057.se
1475293012 gbinv1058.se
1482143964 gbinv1059.se
1499837397 gbinv106.seq
1494061946 gbinv1060.se
1464114370 gbinv1061.se
1491531698 gbinv1062.se
1497907949 gbinv1063.se
1475364582 gbinv1064.se
1496501902 gbinv1065.se
1497963432 gbinv1066.se
1346022599 gbinv1067.se
1438980646 gbinv1068.se
1494493645 gbinv1069.se
1491763985 gbinv107.seq
1495480155 gbinv1070.se
1491251424 gbinv1071.se
1490711424 gbinv1072.se
1484552636 gbinv1073.se
1448522438 gbinv1074.se
1469722899 gbinv1075.se
1437653463 gbinv1076.se
1485028925 gbinv1077.se
1486963335 gbinv1078.se
1371059316 gbinv1079.se
1497867010 gbinv108.seq
1409654376 gbinv1080.se
1494928557 gbinv1081.se
1486273191 gbinv1082.se
1484006451 gbinv1083.se
1249149578 gbinv1084.se
1643334397 gbinv1085.se
1640559275 gbinv1086.se
1497007454 gbinv1087.se
1472669410 gbinv1088.se
1257114488 gbinv1089.se
1477521664 gbinv109.seq
1158932125 gbinv1090.se
1091355196 gbinv1091.se
1482889800 gbinv1092.se
1494854446 gbinv1093.se
1495393792 gbinv1094.se
1495596370 gbinv1095.se
1478743656 gbinv1096.se
1479964443 gbinv1097.se
1212765581 gbinv1098.se
1264461979 gbinv1099.se
1492626839 gbinv11.seq
1494919100 gbinv110.seq
1472053163 gbinv1100.se
1483532093 gbinv1101.se
1485399397 gbinv1102.se
1434901281 gbinv1103.se
1403583746 gbinv1104.se
1490227316 gbinv1105.se
1317975738 gbinv1106.se
1496656117 gbinv1107.se
1491609400 gbinv1108.se
1481611223 gbinv1109.se
1497903939 gbinv111.seq
1464385911 gbinv1110.se
1450685747 gbinv1111.se
1419375364 gbinv1112.se
1414336778 gbinv1113.se
1351486974 gbinv1114.se
1461381661 gbinv1115.se
1265070008 gbinv1116.se
1251689262 gbinv1117.se
1370596003 gbinv1118.se
1415630556 gbinv1119.se
1328438003 gbinv112.seq
1498739889 gbinv1120.se
1481328324 gbinv1121.se
1494373166 gbinv1122.se
1494922448 gbinv1123.se
1483911992 gbinv1124.se
1476556003 gbinv1125.se
1475790671 gbinv1126.se
1495452829 gbinv1127.se
1411677733 gbinv1128.se
1465381535 gbinv1129.se
1358273913 gbinv113.seq
1471952704 gbinv1130.se
1497539317 gbinv1131.se
1460744772 gbinv1132.se
1389161682 gbinv1133.se
1473827110 gbinv1134.se
1417873120 gbinv1135.se
1456967310 gbinv1136.se
1493353917 gbinv1137.se
1487340261 gbinv1138.se
1498920960 gbinv1139.se
1498225362 gbinv114.seq
1416085385 gbinv1140.se
1358960511 gbinv1141.se
1338109968 gbinv1142.se
1489662900 gbinv1143.se
1492101693 gbinv1144.se
1492072825 gbinv1145.se
1461580706 gbinv1146.se
1457626517 gbinv1147.se
1477162019 gbinv1148.se
1276391698 gbinv1149.se
1499999283 gbinv115.seq
1489817886 gbinv1150.se
1396487626 gbinv1151.se
1481870175 gbinv1152.se
1429028367 gbinv1153.se
1466228010 gbinv1154.se
1471599786 gbinv1155.se
1409226181 gbinv1156.se
1496049408 gbinv1157.se
1497966968 gbinv1158.se
1496703581 gbinv1159.se
1499998526 gbinv116.seq
1376644879 gbinv1160.se
1475469470 gbinv1161.se
1474043641 gbinv1162.se
1497987715 gbinv1163.se
1400146863 gbinv1164.se
1496044125 gbinv1165.se
1495327329 gbinv1166.se
1466453485 gbinv1167.se
1496580693 gbinv1168.se
1474274291 gbinv1169.se
1499998316 gbinv117.seq
1496907453 gbinv1170.se
985314136 gbinv1171.se
1434685209 gbinv1172.se
1292747026 gbinv1173.se
1480856124 gbinv1174.se
1480115675 gbinv1175.se
1483223463 gbinv1176.se
1462341069 gbinv1177.se
1352164766 gbinv1178.se
1425694067 gbinv1179.se
1499998715 gbinv118.seq
1490637510 gbinv1180.se
1494985045 gbinv1181.se
1453592569 gbinv1182.se
1387208849 gbinv1183.se
1493940395 gbinv1184.se
1412111547 gbinv1185.se
1455280270 gbinv1186.se
1450773482 gbinv1187.se
1496411866 gbinv1188.se
1478286845 gbinv1189.se
1499558423 gbinv119.seq
1367510272 gbinv1190.se
1465481754 gbinv1191.se
1316758223 gbinv1192.se
1389385209 gbinv1193.se
1472627160 gbinv1194.se
1433155128 gbinv1195.se
1419596117 gbinv1196.se
1479407564 gbinv1197.se
1472462979 gbinv1198.se
1484773551 gbinv1199.se
1462714222 gbinv12.seq
1499999151 gbinv120.seq
1465030164 gbinv1200.se
1498377387 gbinv1201.se
1498993416 gbinv1202.se
1496038390 gbinv1203.se
1493049147 gbinv1204.se
1483457475 gbinv1205.se
1484971549 gbinv1206.se
1478426035 gbinv1207.se
1445780814 gbinv1208.se
1497267302 gbinv1209.se
1499470629 gbinv121.seq
1473441284 gbinv1210.se
1499997103 gbinv1211.se
292632762 gbinv1212.se
1499608745 gbinv122.seq
1499999284 gbinv123.seq
1499999241 gbinv124.seq
1499988446 gbinv125.seq
1500000138 gbinv126.seq
1499982366 gbinv127.seq
1499906803 gbinv128.seq
1499969036 gbinv129.seq
1484460112 gbinv13.seq
1499996087 gbinv130.seq
1499995972 gbinv131.seq
1499998983 gbinv132.seq
1499995141 gbinv133.seq
1499998349 gbinv134.seq
1492026172 gbinv135.seq
1365931992 gbinv136.seq
1431612177 gbinv137.seq
1370092189 gbinv138.seq
1489651536 gbinv139.seq
1491128881 gbinv14.seq
1492917398 gbinv140.seq
1471935787 gbinv141.seq
1226633828 gbinv142.seq
1493002986 gbinv143.seq
1479953735 gbinv144.seq
1486929665 gbinv145.seq
1492896661 gbinv146.seq
1484004775 gbinv147.seq
1493996149 gbinv148.seq
1485173855 gbinv149.seq
1441589560 gbinv15.seq
1461553525 gbinv150.seq
1481545100 gbinv151.seq
1451415933 gbinv152.seq
1168251683 gbinv153.seq
1494835318 gbinv154.seq
1491628057 gbinv155.seq
1386060218 gbinv156.seq
1449522547 gbinv157.seq
1472605027 gbinv158.seq
1480459845 gbinv159.seq
1495133803 gbinv16.seq
1468671486 gbinv160.seq
1497689742 gbinv161.seq
1499381329 gbinv162.seq
1494377026 gbinv163.seq
1492164285 gbinv164.seq
1492864285 gbinv165.seq
1492689288 gbinv166.seq
1347962787 gbinv167.seq
1239197631 gbinv168.seq
1489643071 gbinv169.seq
1429076193 gbinv17.seq
1498523022 gbinv170.seq
1429808750 gbinv171.seq
1210254415 gbinv172.seq
1497850731 gbinv173.seq
1486856363 gbinv174.seq
1473461745 gbinv175.seq
1457783743 gbinv176.seq
1432295701 gbinv177.seq
1476859107 gbinv178.seq
1478810991 gbinv179.seq
1491326951 gbinv18.seq
1470253222 gbinv180.seq
1449415343 gbinv181.seq
1496880191 gbinv182.seq
1456326631 gbinv183.seq
1430905253 gbinv184.seq
1347201702 gbinv185.seq
1495706167 gbinv186.seq
1491112830 gbinv187.seq
1441042971 gbinv188.seq
1497192059 gbinv189.seq
1486256656 gbinv19.seq
1392117025 gbinv190.seq
1413055833 gbinv191.seq
1478247791 gbinv192.seq
1499359194 gbinv193.seq
1444083953 gbinv194.seq
1433502188 gbinv195.seq
1491334103 gbinv196.seq
1499090744 gbinv197.seq
1474205648 gbinv198.seq
1352324854 gbinv199.seq
1484984033 gbinv2.seq
1345048301 gbinv20.seq
1452357984 gbinv200.seq
1326135021 gbinv201.seq
1474729500 gbinv202.seq
1479215552 gbinv203.seq
1491741492 gbinv204.seq
1393950408 gbinv205.seq
1494310694 gbinv206.seq
1494869937 gbinv207.seq
1468825102 gbinv208.seq
1475656757 gbinv209.seq
1497228903 gbinv21.seq
1491813915 gbinv210.seq
1481776571 gbinv211.seq
1483128844 gbinv212.seq
1347544723 gbinv213.seq
1493605679 gbinv214.seq
1483808360 gbinv215.seq
1442433573 gbinv216.seq
1483663747 gbinv217.seq
1495736706 gbinv218.seq
1253874201 gbinv219.seq
1365878064 gbinv22.seq
1494058793 gbinv220.seq
1373457953 gbinv221.seq
1456333883 gbinv222.seq
1484792520 gbinv223.seq
1251829555 gbinv224.seq
1496348692 gbinv225.seq
1357064376 gbinv226.seq
1414953531 gbinv227.seq
1400151225 gbinv228.seq
1466945524 gbinv229.seq
1495369556 gbinv23.seq
1478383808 gbinv230.seq
1496412220 gbinv231.seq
1467309158 gbinv232.seq
1487856483 gbinv233.seq
1487920343 gbinv234.seq
1489288989 gbinv235.seq
1487693141 gbinv236.seq
1288775238 gbinv237.seq
1382524196 gbinv238.seq
1357845048 gbinv239.seq
1497397110 gbinv24.seq
1486585874 gbinv240.seq
1486937267 gbinv241.seq
1488381993 gbinv242.seq
1476145037 gbinv243.seq
1438012610 gbinv244.seq
1477110064 gbinv245.seq
1498672461 gbinv246.seq
1473777568 gbinv247.seq
1462092039 gbinv248.seq
1333371159 gbinv249.seq
1487539277 gbinv25.seq
1385396260 gbinv250.seq
1369192781 gbinv251.seq
1499860066 gbinv252.seq
1475265022 gbinv253.seq
1425069576 gbinv254.seq
1420464715 gbinv255.seq
1495216681 gbinv256.seq
1455206750 gbinv257.seq
1472299211 gbinv258.seq
1493240415 gbinv259.seq
1482416452 gbinv26.seq
1438071355 gbinv260.seq
1352328131 gbinv261.seq
1481801525 gbinv262.seq
1417458943 gbinv263.seq
1498587547 gbinv264.seq
1474622826 gbinv265.seq
1469629928 gbinv266.seq
1389695051 gbinv267.seq
1454625956 gbinv268.seq
1473986511 gbinv269.seq
1474595585 gbinv27.seq
1492283405 gbinv270.seq
1463168127 gbinv271.seq
1391973732 gbinv272.seq
1456232875 gbinv273.seq
1437755108 gbinv274.seq
1492924934 gbinv275.seq
1325973548 gbinv276.seq
1499332945 gbinv277.seq
1445909632 gbinv278.seq
1495816197 gbinv279.seq
1491204592 gbinv28.seq
1443202585 gbinv280.seq
1480225589 gbinv281.seq
1442908071 gbinv282.seq
1478166345 gbinv283.seq
1489195348 gbinv284.seq
1480031166 gbinv285.seq
1499676154 gbinv286.seq
1485192064 gbinv287.seq
1372921321 gbinv288.seq
1416726958 gbinv289.seq
1488698230 gbinv29.seq
1447728294 gbinv290.seq
1439652819 gbinv291.seq
1442618626 gbinv292.seq
1426894153 gbinv293.seq
1447226340 gbinv294.seq
1487195331 gbinv295.seq
1483792235 gbinv296.seq
1490454343 gbinv297.seq
1383487641 gbinv298.seq
1488575579 gbinv299.seq
1496070030 gbinv3.seq
1476172400 gbinv30.seq
1495179183 gbinv300.seq
1464715247 gbinv301.seq
1493913805 gbinv302.seq
1489979595 gbinv303.seq
1427512355 gbinv304.seq
1457194355 gbinv305.seq
1489488513 gbinv306.seq
1495947464 gbinv307.seq
1325794030 gbinv308.seq
1494136720 gbinv309.seq
1476172889 gbinv31.seq
1477159575 gbinv310.seq
1467829201 gbinv311.seq
1454855814 gbinv312.seq
1493852374 gbinv313.seq
1498242095 gbinv314.seq
1450415736 gbinv315.seq
1474891878 gbinv316.seq
1470758742 gbinv317.seq
1495937980 gbinv318.seq
623335680 gbinv319.seq
1474806070 gbinv32.seq
2729769834 gbinv320.seq
1951209797 gbinv321.seq
1255792905 gbinv322.seq
898357564 gbinv323.seq
1390359247 gbinv324.seq
1466020132 gbinv325.seq
1443272573 gbinv326.seq
1475387842 gbinv327.seq
1497205510 gbinv328.seq
1467101040 gbinv329.seq
1473690566 gbinv33.seq
1496389311 gbinv330.seq
1499117653 gbinv331.seq
1462931194 gbinv332.seq
1487873497 gbinv333.seq
1277578135 gbinv334.seq
1487639321 gbinv335.seq
1456188446 gbinv336.seq
1499002056 gbinv337.seq
1480066049 gbinv338.seq
1454211592 gbinv339.seq
1481151563 gbinv34.seq
1222756177 gbinv340.seq
1477554828 gbinv341.seq
1486108915 gbinv342.seq
1427447559 gbinv343.seq
1483162232 gbinv344.seq
1485243570 gbinv345.seq
1410776048 gbinv346.seq
1475127917 gbinv347.seq
1479038418 gbinv348.seq
1425853319 gbinv349.seq
1486086620 gbinv35.seq
1481373985 gbinv350.seq
1490243609 gbinv351.seq
1483879579 gbinv352.seq
1414434060 gbinv353.seq
1457292205 gbinv354.seq
1477018477 gbinv355.seq
1409025156 gbinv356.seq
1474794456 gbinv357.seq
1494012052 gbinv358.seq
1465696815 gbinv359.seq
1127234573 gbinv36.seq
1494483077 gbinv360.seq
1459440397 gbinv361.seq
1494957101 gbinv362.seq
1491910109 gbinv363.seq
1481624627 gbinv364.seq
1479042031 gbinv365.seq
1495864056 gbinv366.seq
1479577884 gbinv367.seq
1494515876 gbinv368.seq
1364399555 gbinv369.seq
1278053548 gbinv37.seq
1448613839 gbinv370.seq
1492450027 gbinv371.seq
1481797904 gbinv372.seq
1448615210 gbinv373.seq
1497318133 gbinv374.seq
1482942294 gbinv375.seq
1491980118 gbinv376.seq
1474614077 gbinv377.seq
1493902565 gbinv378.seq
1278522756 gbinv379.seq
1492952945 gbinv38.seq
1482901794 gbinv380.seq
1456649541 gbinv381.seq
1434040304 gbinv382.seq
1484220657 gbinv383.seq
1480269708 gbinv384.seq
1477251799 gbinv385.seq
1488642106 gbinv386.seq
1464325796 gbinv387.seq
1338568836 gbinv388.seq
1490699998 gbinv389.seq
1448400892 gbinv39.seq
1419620460 gbinv390.seq
1476857168 gbinv391.seq
1483484812 gbinv392.seq
1491577966 gbinv393.seq
1491112499 gbinv394.seq
1479699030 gbinv395.seq
1480538403 gbinv396.seq
1472167723 gbinv397.seq
1486100359 gbinv398.seq
1481117526 gbinv399.seq
1492635630 gbinv4.seq
1422007802 gbinv40.seq
1492071757 gbinv400.seq
1499340126 gbinv401.seq
1497229819 gbinv402.seq
1479610041 gbinv403.seq
1483481633 gbinv404.seq
1474121526 gbinv405.seq
1490369993 gbinv406.seq
1405673874 gbinv407.seq
1458938909 gbinv408.seq
1349464140 gbinv409.seq
1489355517 gbinv41.seq
1495749208 gbinv410.seq
1476876176 gbinv411.seq
1473968850 gbinv412.seq
1323353583 gbinv413.seq
1491101509 gbinv414.seq
1484946141 gbinv415.seq
1470944398 gbinv416.seq
1472332405 gbinv417.seq
1481542660 gbinv418.seq
1492837082 gbinv419.seq
1497259295 gbinv42.seq
1479414174 gbinv420.seq
1466552136 gbinv421.seq
1431499002 gbinv422.seq
1485071634 gbinv423.seq
1494313967 gbinv424.seq
1493657170 gbinv425.seq
1480261094 gbinv426.seq
1483044191 gbinv427.seq
1445615250 gbinv428.seq
1497887640 gbinv429.seq
1423029131 gbinv43.seq
1471083260 gbinv430.seq
1497577480 gbinv431.seq
1499666284 gbinv432.seq
1460233365 gbinv433.seq
1496183446 gbinv434.seq
1498835879 gbinv435.seq
1473136630 gbinv436.seq
1479632452 gbinv437.seq
1208341643 gbinv438.seq
1475939186 gbinv439.seq
1454563907 gbinv44.seq
1492673455 gbinv440.seq
1461443834 gbinv441.seq
1499017367 gbinv442.seq
1480639218 gbinv443.seq
1489253829 gbinv444.seq
1499684437 gbinv445.seq
1498373944 gbinv446.seq
1477680980 gbinv447.seq
1469115028 gbinv448.seq
1486876777 gbinv449.seq
1395931359 gbinv45.seq
1494514455 gbinv450.seq
1419644627 gbinv451.seq
1498250624 gbinv452.seq
1487133459 gbinv453.seq
1393203164 gbinv454.seq
1408820705 gbinv455.seq
1497592776 gbinv456.seq
1478543833 gbinv457.seq
1392852049 gbinv458.seq
1499169382 gbinv459.seq
1275329755 gbinv46.seq
1466213638 gbinv460.seq
1469972842 gbinv461.seq
1457228715 gbinv462.seq
1497717270 gbinv463.seq
1494988855 gbinv464.seq
1278804881 gbinv465.seq
1380109384 gbinv466.seq
1386694032 gbinv467.seq
1420319566 gbinv468.seq
1318232257 gbinv469.seq
1283838707 gbinv47.seq
1488909769 gbinv470.seq
1481543720 gbinv471.seq
1481572537 gbinv472.seq
1479361265 gbinv473.seq
1401152941 gbinv474.seq
1496970113 gbinv475.seq
1478315302 gbinv476.seq
1429811506 gbinv477.seq
1376843258 gbinv478.seq
1465003259 gbinv479.seq
1485923052 gbinv48.seq
1497423367 gbinv480.seq
1346892194 gbinv481.seq
1454126994 gbinv482.seq
1487412138 gbinv483.seq
1483868694 gbinv484.seq
1473633031 gbinv485.seq
1482689248 gbinv486.seq
1452173892 gbinv487.seq
1499910356 gbinv488.seq
1464467532 gbinv489.seq
1440677712 gbinv49.seq
1485513855 gbinv490.seq
1482623541 gbinv491.seq
1494124998 gbinv492.seq
1497608690 gbinv493.seq
1457065445 gbinv494.seq
1311857016 gbinv495.seq
1474908251 gbinv496.seq
882426802 gbinv497.seq
1391549013 gbinv498.seq
1469092788 gbinv499.seq
1495542399 gbinv5.seq
1385129756 gbinv50.seq
1473448155 gbinv500.seq
1478007974 gbinv501.seq
1483031812 gbinv502.seq
1499113062 gbinv503.seq
1414071112 gbinv504.seq
1488672225 gbinv505.seq
1436891465 gbinv506.seq
1470426165 gbinv507.seq
994114412 gbinv508.seq
1495303361 gbinv509.seq
1435161660 gbinv51.seq
1489955112 gbinv510.seq
1463095666 gbinv511.seq
1444565030 gbinv512.seq
1476941483 gbinv513.seq
1476771081 gbinv514.seq
1383246824 gbinv515.seq
1452869539 gbinv516.seq
1478517605 gbinv517.seq
1495371589 gbinv518.seq
1467297527 gbinv519.seq
1295847074 gbinv52.seq
1460534329 gbinv520.seq
1461098798 gbinv521.seq
1414146754 gbinv522.seq
1468601310 gbinv523.seq
1496553038 gbinv524.seq
1481179326 gbinv525.seq
1496915445 gbinv526.seq
1400120857 gbinv527.seq
1489117723 gbinv528.seq
1490001542 gbinv529.seq
1425921307 gbinv53.seq
1472483720 gbinv530.seq
1484543524 gbinv531.seq
1497533122 gbinv532.seq
1498095048 gbinv533.seq
1485800779 gbinv534.seq
1451959467 gbinv535.seq
1339662122 gbinv536.seq
1285411718 gbinv537.seq
1403179825 gbinv538.seq
1463090834 gbinv539.seq
1236415004 gbinv54.seq
1487090635 gbinv540.seq
1413426091 gbinv541.seq
1313629197 gbinv542.seq
1478845791 gbinv543.seq
1422907245 gbinv544.seq
1482655612 gbinv545.seq
1358285902 gbinv546.seq
1442882432 gbinv547.seq
1494791321 gbinv548.seq
1474942351 gbinv549.seq
1444665791 gbinv55.seq
1439290780 gbinv550.seq
1449238385 gbinv551.seq
1477198309 gbinv552.seq
1366129901 gbinv553.seq
1493069824 gbinv554.seq
1491415882 gbinv555.seq
1473668442 gbinv556.seq
1386898604 gbinv557.seq
1347917131 gbinv558.seq
1309168704 gbinv559.seq
1264323171 gbinv56.seq
1436243774 gbinv560.seq
1389671116 gbinv561.seq
1449300137 gbinv562.seq
1492678269 gbinv563.seq
1458594377 gbinv564.seq
1492844340 gbinv565.seq
1452199723 gbinv566.seq
1476212405 gbinv567.seq
1486194223 gbinv568.seq
1495140895 gbinv569.seq
1430683735 gbinv57.seq
1287096563 gbinv570.seq
1374386504 gbinv571.seq
1468997307 gbinv572.seq
1494920149 gbinv573.seq
1495343415 gbinv574.seq
1490343966 gbinv575.seq
1489624021 gbinv576.seq
1487080559 gbinv577.seq
1498747450 gbinv578.seq
1395302798 gbinv579.seq
1455927429 gbinv58.seq
1485284949 gbinv580.seq
1435694157 gbinv581.seq
1470723522 gbinv582.seq
1484916015 gbinv583.seq
1483150132 gbinv584.seq
1331454162 gbinv585.seq
1356210496 gbinv586.seq
1416749796 gbinv587.seq
1452284984 gbinv588.seq
1488148955 gbinv589.seq
1482096513 gbinv59.seq
1495268123 gbinv590.seq
1461920210 gbinv591.seq
1490950525 gbinv592.seq
1372238232 gbinv593.seq
1390606238 gbinv594.seq
1458894443 gbinv595.seq
1493654155 gbinv596.seq
1499866432 gbinv597.seq
1462171534 gbinv598.seq
1470312188 gbinv599.seq
1484462816 gbinv6.seq
1499998121 gbinv60.seq
1491213345 gbinv600.seq
1200607082 gbinv601.seq
1474599992 gbinv602.seq
1226521611 gbinv603.seq
1438661071 gbinv604.seq
1489193064 gbinv605.seq
1211826488 gbinv606.seq
1440385609 gbinv607.seq
1477656292 gbinv608.seq
1498234427 gbinv609.seq
1497402906 gbinv61.seq
1499137795 gbinv610.seq
1474254297 gbinv611.seq
1437961059 gbinv612.seq
1465982476 gbinv613.seq
1476362632 gbinv614.seq
1353205190 gbinv615.seq
1461561561 gbinv616.seq
1480265953 gbinv617.seq
1477136556 gbinv618.seq
1413880691 gbinv619.seq
1497158716 gbinv62.seq
1493749227 gbinv620.seq
1489227625 gbinv621.seq
1127804764 gbinv622.seq
1467406139 gbinv623.seq
1349338312 gbinv624.seq
1466084609 gbinv625.seq
1499595036 gbinv626.seq
1493518373 gbinv627.seq
1482408313 gbinv628.seq
1489972607 gbinv629.seq
1497189577 gbinv63.seq
1457477267 gbinv630.seq
1498514187 gbinv631.seq
1484260363 gbinv632.seq
1313458207 gbinv633.seq
1489473064 gbinv634.seq
1467231749 gbinv635.seq
1496514080 gbinv636.seq
1476538751 gbinv637.seq
1466376780 gbinv638.seq
1462399182 gbinv639.seq
1496580301 gbinv64.seq
1477737198 gbinv640.seq
1424791995 gbinv641.seq
1468769087 gbinv642.seq
1497913605 gbinv643.seq
1271418322 gbinv644.seq
1301564944 gbinv645.seq
1471879735 gbinv646.seq
1053677687 gbinv647.seq
1380265120 gbinv648.seq
1396131978 gbinv649.seq
1483913545 gbinv65.seq
1489554947 gbinv650.seq
1433410472 gbinv651.seq
1351353812 gbinv652.seq
1242394563 gbinv653.seq
1499324418 gbinv654.seq
1473661888 gbinv655.seq
1449356018 gbinv656.seq
1475967180 gbinv657.seq
1493682979 gbinv658.seq
1495997887 gbinv659.seq
1492268466 gbinv66.seq
1469126947 gbinv660.seq
1296705383 gbinv661.seq
1466230627 gbinv662.seq
1343924683 gbinv663.seq
1496203289 gbinv664.seq
1484700308 gbinv665.seq
1188685701 gbinv666.seq
1441258603 gbinv667.seq
1462772577 gbinv668.seq
1495266184 gbinv669.seq
1434643625 gbinv67.seq
1494695214 gbinv670.seq
1391522890 gbinv671.seq
1470077879 gbinv672.seq
1294029204 gbinv673.seq
1274422615 gbinv674.seq
1205408689 gbinv675.seq
1104142746 gbinv676.seq
1036632038 gbinv677.seq
1332903523 gbinv678.seq
1190138460 gbinv679.seq
1491972535 gbinv68.seq
1381167273 gbinv680.seq
1482941221 gbinv681.seq
1334265228 gbinv682.seq
1420389028 gbinv683.seq
1404385637 gbinv684.seq
1460306639 gbinv685.seq
1462227058 gbinv686.seq
1436988806 gbinv687.seq
1491802675 gbinv688.seq
1492108404 gbinv689.seq
1497830828 gbinv69.seq
1367921076 gbinv690.seq
1494199652 gbinv691.seq
1123984168 gbinv692.seq
874599051 gbinv693.seq
872525010 gbinv694.seq
810605264 gbinv695.seq
791733648 gbinv696.seq
789407447 gbinv697.seq
782472280 gbinv698.seq
1478877159 gbinv699.seq
1489678481 gbinv7.seq
1494749301 gbinv70.seq
1425054466 gbinv700.seq
1232428257 gbinv701.seq
1449091071 gbinv702.seq
1494178824 gbinv703.seq
1451306539 gbinv704.seq
1446725042 gbinv705.seq
1492012562 gbinv706.seq
1485251352 gbinv707.seq
1440797550 gbinv708.seq
1489644341 gbinv709.seq
1497628510 gbinv71.seq
1129926582 gbinv710.seq
1478985096 gbinv711.seq
1436917067 gbinv712.seq
1304573259 gbinv713.seq
1447912985 gbinv714.seq
1477159679 gbinv715.seq
1441002488 gbinv716.seq
1358342669 gbinv717.seq
1495926001 gbinv718.seq
1489540966 gbinv719.seq
1477587631 gbinv72.seq
1385541461 gbinv720.seq
1490668437 gbinv721.seq
1498773544 gbinv722.seq
1494280310 gbinv723.seq
1478659130 gbinv724.seq
1490369912 gbinv725.seq
1454124707 gbinv726.seq
1480065591 gbinv727.seq
1477473627 gbinv728.seq
1458431340 gbinv729.seq
1484953234 gbinv73.seq
1267258270 gbinv730.seq
1499431451 gbinv731.seq
1384116066 gbinv732.seq
1474301866 gbinv733.seq
1204760525 gbinv734.seq
1460137155 gbinv735.seq
1476820917 gbinv736.seq
1353805130 gbinv737.seq
1413692605 gbinv738.seq
1470780301 gbinv739.seq
1475516247 gbinv74.seq
1484656775 gbinv740.seq
1469691984 gbinv741.seq
1495706071 gbinv742.seq
1297579497 gbinv743.seq
1375759104 gbinv744.seq
1454532764 gbinv745.seq
1497622251 gbinv746.seq
1370789184 gbinv747.seq
1487438153 gbinv748.seq
1492926956 gbinv749.seq
1459292510 gbinv75.seq
1492982005 gbinv750.seq
1447577144 gbinv751.seq
1431751206 gbinv752.seq
1489605332 gbinv753.seq
1473901953 gbinv754.seq
1460311830 gbinv755.seq
1453756526 gbinv756.seq
1382808281 gbinv757.seq
1482348831 gbinv758.seq
1487170658 gbinv759.seq
1489330722 gbinv76.seq
1059460203 gbinv760.seq
1191529685 gbinv761.seq
1176457428 gbinv762.seq
1118724487 gbinv763.seq
1448943866 gbinv764.seq
1436999462 gbinv765.seq
1484686767 gbinv766.seq
1440414567 gbinv767.seq
1462302632 gbinv768.seq
1488222097 gbinv769.seq
1497993577 gbinv77.seq
1477654772 gbinv770.seq
1489253061 gbinv771.seq
1461105919 gbinv772.seq
1476470435 gbinv773.seq
1456148858 gbinv774.seq
1414082664 gbinv775.seq
1496089203 gbinv776.seq
1489436610 gbinv777.seq
1434779449 gbinv778.seq
1490169327 gbinv779.seq
1492579803 gbinv78.seq
1436479661 gbinv780.seq
1443656233 gbinv781.seq
1497278333 gbinv782.seq
1482389324 gbinv783.seq
1475136219 gbinv784.seq
1372239564 gbinv785.seq
1391999432 gbinv786.seq
1453801728 gbinv787.seq
1497276601 gbinv788.seq
1488917878 gbinv789.seq
1489504396 gbinv79.seq
1343377050 gbinv790.seq
1431137590 gbinv791.seq
1470649030 gbinv792.seq
1495673684 gbinv793.seq
1484392436 gbinv794.seq
1370380432 gbinv795.seq
1271919212 gbinv796.seq
1302247251 gbinv797.seq
1373305750 gbinv798.seq
1375693754 gbinv799.seq
1394033553 gbinv8.seq
1444509936 gbinv80.seq
1464671547 gbinv800.seq
1459541391 gbinv801.seq
1489406014 gbinv802.seq
1490586273 gbinv803.seq
1493837031 gbinv804.seq
1400217161 gbinv805.seq
1413210457 gbinv806.seq
1490609103 gbinv807.seq
1497732234 gbinv808.seq
1219453804 gbinv809.seq
1499997399 gbinv81.seq
1264302105 gbinv810.seq
1485822787 gbinv811.seq
1418685694 gbinv812.seq
1482216219 gbinv813.seq
1417478148 gbinv814.seq
1494543420 gbinv815.seq
1417238152 gbinv816.seq
1366812572 gbinv817.seq
1494164508 gbinv818.seq
999979249 gbinv819.seq
1499999286 gbinv82.seq
1368086882 gbinv820.seq
1408574610 gbinv821.seq
1498538060 gbinv822.seq
1397635787 gbinv823.seq
1081620411 gbinv824.seq
1431826102 gbinv825.seq
1401372891 gbinv826.seq
1448756584 gbinv827.seq
1488109642 gbinv828.seq
1489078785 gbinv829.seq
1499999379 gbinv83.seq
1460733085 gbinv830.seq
1474715637 gbinv831.seq
1472124950 gbinv832.seq
1423732997 gbinv833.seq
1431479439 gbinv834.seq
1414088464 gbinv835.seq
1427352077 gbinv836.seq
1486209499 gbinv837.seq
1439790711 gbinv838.seq
1345947195 gbinv839.seq
1499998849 gbinv84.seq
1409851510 gbinv840.seq
1497428187 gbinv841.seq
1491627673 gbinv842.seq
1407776038 gbinv843.seq
1486091565 gbinv844.seq
1447417163 gbinv845.seq
1424173333 gbinv846.seq
1471376235 gbinv847.seq
1483914009 gbinv848.seq
1476924389 gbinv849.seq
1499998722 gbinv85.seq
1495375621 gbinv850.seq
1482546700 gbinv851.seq
1477023133 gbinv852.seq
1484489275 gbinv853.seq
1364991275 gbinv854.seq
1327457514 gbinv855.seq
1445905313 gbinv856.seq
1480024427 gbinv857.seq
1492427545 gbinv858.seq
1483237802 gbinv859.seq
1499979799 gbinv86.seq
1334750785 gbinv860.seq
1340130480 gbinv861.seq
1428711159 gbinv862.seq
1292257015 gbinv863.seq
1453904599 gbinv864.seq
1490727749 gbinv865.seq
1479824478 gbinv866.seq
1446168967 gbinv867.seq
1483787681 gbinv868.seq
1234619110 gbinv869.seq
1499997677 gbinv87.seq
1489639731 gbinv870.seq
1478350948 gbinv871.seq
1472613421 gbinv872.seq
1314863017 gbinv873.seq
1492845810 gbinv874.seq
1482657208 gbinv875.seq
1490433581 gbinv876.seq
1491351228 gbinv877.seq
1459189685 gbinv878.seq
1438910128 gbinv879.seq
1499998062 gbinv88.seq
1165149605 gbinv880.seq
1443358202 gbinv881.seq
1231751195 gbinv882.seq
1465887213 gbinv883.seq
1427380300 gbinv884.seq
1498007467 gbinv885.seq
1492780193 gbinv886.seq
1310752098 gbinv887.seq
1491528231 gbinv888.seq
1372427027 gbinv889.seq
1499992839 gbinv89.seq
1429260753 gbinv890.seq
1491982766 gbinv891.seq
1499828325 gbinv892.seq
1489546318 gbinv893.seq
1450002164 gbinv894.seq
1432656175 gbinv895.seq
1492803541 gbinv896.seq
1483685180 gbinv897.seq
1494338837 gbinv898.seq
1489389384 gbinv899.seq
1493250714 gbinv9.seq
1499999690 gbinv90.seq
1486778238 gbinv900.seq
1434934426 gbinv901.seq
1455774368 gbinv902.seq
1486106378 gbinv903.seq
1499848716 gbinv904.seq
1473633903 gbinv905.seq
1482973725 gbinv906.seq
1484222044 gbinv907.seq
1488305213 gbinv908.seq
1341678524 gbinv909.seq
1497888261 gbinv91.seq
1442932031 gbinv910.seq
1495746307 gbinv911.seq
1498425116 gbinv912.seq
1439194314 gbinv913.seq
1478270733 gbinv914.seq
1494920288 gbinv915.seq
1460584282 gbinv916.seq
1487364619 gbinv917.seq
1497676087 gbinv918.seq
1479051946 gbinv919.seq
1438818455 gbinv92.seq
1487083952 gbinv920.seq
1497354730 gbinv921.seq
1455384863 gbinv922.seq
1481656710 gbinv923.seq
1422592874 gbinv924.seq
1486259454 gbinv925.seq
1496078122 gbinv926.seq
1494276352 gbinv927.seq
1497276141 gbinv928.seq
1457705968 gbinv929.seq
1466335164 gbinv93.seq
1452771475 gbinv930.seq
1337144687 gbinv931.seq
1492176983 gbinv932.seq
1485150868 gbinv933.seq
1495278047 gbinv934.seq
1475008435 gbinv935.seq
1498947149 gbinv936.seq
1472536133 gbinv937.seq
1498507310 gbinv938.seq
1499942165 gbinv939.seq
1499621340 gbinv94.seq
1466342212 gbinv940.seq
1472050712 gbinv941.seq
1492159701 gbinv942.seq
1495894532 gbinv943.seq
1496016829 gbinv944.seq
1475317343 gbinv945.seq
1474568294 gbinv946.seq
1438072296 gbinv947.seq
1494607055 gbinv948.seq
1490886729 gbinv949.seq
1479771612 gbinv95.seq
1479101082 gbinv950.seq
1402632874 gbinv951.seq
1478348328 gbinv952.seq
1445542854 gbinv953.seq
1493783690 gbinv954.seq
1494864231 gbinv955.seq
1456882204 gbinv956.seq
1498195733 gbinv957.seq
1481786457 gbinv958.seq
1484032756 gbinv959.seq
1463330795 gbinv96.seq
1485547351 gbinv960.seq
1486001132 gbinv961.seq
1488420372 gbinv962.seq
1442129992 gbinv963.seq
1466077407 gbinv964.seq
1499748615 gbinv965.seq
1451014090 gbinv966.seq
1491533135 gbinv967.seq
1474040893 gbinv968.seq
1377730255 gbinv969.seq
1482759897 gbinv97.seq
1396391863 gbinv970.seq
1476640185 gbinv971.seq
1489968019 gbinv972.seq
1487861140 gbinv973.seq
1485537198 gbinv974.seq
1499625751 gbinv975.seq
1484465404 gbinv976.seq
1426415254 gbinv977.seq
1475823352 gbinv978.seq
1493390820 gbinv979.seq
1498616998 gbinv98.seq
1454462171 gbinv980.seq
1352129141 gbinv981.seq
1481827757 gbinv982.seq
1485321858 gbinv983.seq
1491490205 gbinv984.seq
1473282801 gbinv985.seq
1474812334 gbinv986.seq
1455288730 gbinv987.seq
1460050941 gbinv988.seq
1321445242 gbinv989.seq
1483002179 gbinv99.seq
1289149103 gbinv990.seq
1295409175 gbinv991.seq
1314219184 gbinv992.seq
1326818662 gbinv993.seq
1432750157 gbinv994.seq
1499348985 gbinv995.seq
1402001737 gbinv996.seq
1489762578 gbinv997.seq
1495800702 gbinv998.seq
1499680770 gbinv999.seq
1299921795 gbmam1.seq
1433374449 gbmam10.seq
1306087104 gbmam100.seq
1430476511 gbmam101.seq
1449916654 gbmam102.seq
1364157134 gbmam103.seq
1382213566 gbmam104.seq
1498676378 gbmam105.seq
1438757409 gbmam106.seq
1384358697 gbmam107.seq
1344501950 gbmam108.seq
1356418005 gbmam109.seq
1452368889 gbmam11.seq
1450451476 gbmam110.seq
1481466561 gbmam111.seq
1435707480 gbmam112.seq
1357653362 gbmam113.seq
1499774726 gbmam114.seq
1275040099 gbmam115.seq
1289027473 gbmam116.seq
1383998815 gbmam117.seq
1371963584 gbmam118.seq
1408704474 gbmam119.seq
1440036034 gbmam12.seq
1417170244 gbmam120.seq
1476795247 gbmam121.seq
1393897162 gbmam122.seq
1494577002 gbmam123.seq
1318911633 gbmam124.seq
1475290767 gbmam125.seq
1485363650 gbmam126.seq
1476657140 gbmam127.seq
1370959145 gbmam128.seq
1435239182 gbmam129.seq
1497426774 gbmam13.seq
1421963565 gbmam130.seq
1265661494 gbmam131.seq
1322489185 gbmam132.seq
1498720323 gbmam133.seq
1468071162 gbmam134.seq
1482316458 gbmam135.seq
1406515127 gbmam136.seq
1468808675 gbmam137.seq
1486469699 gbmam138.seq
1419745399 gbmam139.seq
1487057346 gbmam14.seq
1379376566 gbmam140.seq
1392387812 gbmam141.seq
1498621108 gbmam142.seq
1424747897 gbmam143.seq
1444039328 gbmam144.seq
1495905279 gbmam145.seq
1431972134 gbmam146.seq
1453650462 gbmam147.seq
1466469937 gbmam148.seq
1359653884 gbmam149.seq
1433300115 gbmam15.seq
1486040441 gbmam150.seq
1476612439 gbmam151.seq
1250005791 gbmam152.seq
1428977139 gbmam153.seq
1466316317 gbmam154.seq
1440958612 gbmam155.seq
1398606775 gbmam156.seq
1429174374 gbmam157.seq
1307257965 gbmam158.seq
1318147645 gbmam159.seq
1485894617 gbmam16.seq
1407278050 gbmam160.seq
1320959487 gbmam161.seq
1474063572 gbmam162.seq
1388816833 gbmam163.seq
1467771387 gbmam164.seq
1363106222 gbmam165.seq
1382304578 gbmam166.seq
1332943460 gbmam167.seq
1419187584 gbmam168.seq
1343504652 gbmam169.seq
1345861608 gbmam17.seq
1459351509 gbmam170.seq
1372681445 gbmam171.seq
1404486978 gbmam172.seq
1156514820 gbmam173.seq
1404073848 gbmam18.seq
1315922420 gbmam19.seq
1490951841 gbmam2.seq
1367843978 gbmam20.seq
1468252034 gbmam21.seq
1393139762 gbmam22.seq
1466817553 gbmam23.seq
1488080656 gbmam24.seq
1483917563 gbmam25.seq
1434132825 gbmam26.seq
1485351268 gbmam27.seq
1453128998 gbmam28.seq
1494333882 gbmam29.seq
1141239573 gbmam3.seq
1464519465 gbmam30.seq
1441977794 gbmam31.seq
1446827567 gbmam32.seq
1455111173 gbmam33.seq
1385308836 gbmam34.seq
1424749144 gbmam35.seq
1410339361 gbmam36.seq
1378454484 gbmam37.seq
1434286183 gbmam38.seq
1499999012 gbmam39.seq
1342505130 gbmam4.seq
1487389281 gbmam40.seq
1480436127 gbmam41.seq
1406368039 gbmam42.seq
907465328 gbmam43.seq
839494897 gbmam44.seq
1363269325 gbmam45.seq
1343119710 gbmam46.seq
1465682461 gbmam47.seq
1327495418 gbmam48.seq
1455155074 gbmam49.seq
1484831122 gbmam5.seq
1403782937 gbmam50.seq
1389175376 gbmam51.seq
1460772173 gbmam52.seq
1499643620 gbmam53.seq
1494407093 gbmam54.seq
1412940748 gbmam55.seq
1383327549 gbmam56.seq
1473290653 gbmam57.seq
1411021419 gbmam58.seq
1443634265 gbmam59.seq
1429536704 gbmam6.seq
1399808988 gbmam60.seq
1372697093 gbmam61.seq
1445899120 gbmam62.seq
1487459605 gbmam63.seq
1446030419 gbmam64.seq
1491900321 gbmam65.seq
1447662228 gbmam66.seq
1288272320 gbmam67.seq
1489541175 gbmam68.seq
1367385872 gbmam69.seq
1485960787 gbmam7.seq
1433690311 gbmam70.seq
1367200168 gbmam71.seq
1407233551 gbmam72.seq
1437343447 gbmam73.seq
1344751550 gbmam74.seq
1487484232 gbmam75.seq
1418284918 gbmam76.seq
1499602081 gbmam77.seq
1297485464 gbmam78.seq
1441482016 gbmam79.seq
1435168677 gbmam8.seq
1345159341 gbmam80.seq
1472528753 gbmam81.seq
1427875805 gbmam82.seq
1399062857 gbmam83.seq
1414660891 gbmam84.seq
1404065710 gbmam85.seq
1471139449 gbmam86.seq
1360004244 gbmam87.seq
1498868645 gbmam88.seq
1463009820 gbmam89.seq
1460040942 gbmam9.seq
1456467538 gbmam90.seq
1375828767 gbmam91.seq
1499523909 gbmam92.seq
1445611423 gbmam93.seq
1449752142 gbmam94.seq
1496616060 gbmam95.seq
1436171585 gbmam96.seq
1444940922 gbmam97.seq
1410643331 gbmam98.seq
1473092164 gbmam99.seq
20650934 gbnew.txt
1499997985 gbpat1.seq
1499999517 gbpat10.seq
1499998858 gbpat11.seq
1499145260 gbpat12.seq
1500000080 gbpat13.seq
1499998951 gbpat14.seq
1499999818 gbpat15.seq
1500000061 gbpat16.seq
1499996465 gbpat17.seq
1499999649 gbpat18.seq
1499998852 gbpat19.seq
1499993444 gbpat2.seq
1499997330 gbpat20.seq
1499999596 gbpat21.seq
1499999778 gbpat22.seq
1499999953 gbpat23.seq
1499997274 gbpat24.seq
1499999929 gbpat25.seq
1497542892 gbpat26.seq
1499998437 gbpat27.seq
1499946758 gbpat28.seq
1499999160 gbpat29.seq
1499999637 gbpat3.seq
1499999142 gbpat30.seq
1498579393 gbpat31.seq
1499999929 gbpat32.seq
1500000105 gbpat33.seq
1499995973 gbpat34.seq
1499999730 gbpat35.seq
1499997614 gbpat36.seq
1500000127 gbpat37.seq
1500000210 gbpat38.seq
1499999998 gbpat39.seq
1499999346 gbpat4.seq
1498597258 gbpat40.seq
1499942497 gbpat41.seq
1499998206 gbpat42.seq
1499999623 gbpat43.seq
1499999773 gbpat44.seq
1499998781 gbpat45.seq
1499999428 gbpat46.seq
1499998258 gbpat47.seq
1499999055 gbpat48.seq
1499994372 gbpat49.seq
1499945843 gbpat5.seq
1499999734 gbpat50.seq
1499997855 gbpat51.seq
1499938289 gbpat52.seq
1499999672 gbpat53.seq
1499999447 gbpat54.seq
1499999295 gbpat55.seq
1499999442 gbpat56.seq
1500000214 gbpat57.seq
1499998128 gbpat58.seq
1499996741 gbpat59.seq
1499999766 gbpat6.seq
1499986020 gbpat60.seq
1499998796 gbpat61.seq
1499999477 gbpat62.seq
1499856312 gbpat63.seq
1499866922 gbpat64.seq
1499480501 gbpat65.seq
1477061152 gbpat66.seq
1499999964 gbpat67.seq
1499999260 gbpat68.seq
1499999313 gbpat69.seq
1500000160 gbpat7.seq
1499999159 gbpat70.seq
1499999536 gbpat71.seq
1499955189 gbpat72.seq
1499998676 gbpat73.seq
1499998664 gbpat74.seq
1499998820 gbpat75.seq
1499997400 gbpat76.seq
1499999097 gbpat77.seq
1500000227 gbpat78.seq
1499979153 gbpat79.seq
1499988202 gbpat8.seq
1499999925 gbpat80.seq
1278527873 gbpat81.seq
1499999906 gbpat9.seq
1499998293 gbphg1.seq
1499761309 gbphg2.seq
920983029 gbphg3.seq
1499944594 gbpln1.seq
1490892671 gbpln10.seq
1497460973 gbpln100.seq
839340148 gbpln1000.se
793588555 gbpln1001.se
778845059 gbpln1002.se
1471514124 gbpln1003.se
1460672453 gbpln1004.se
847689175 gbpln1005.se
797030463 gbpln1006.se
776617524 gbpln1007.se
1450233858 gbpln1008.se
1469651463 gbpln1009.se
1497729906 gbpln101.seq
834034797 gbpln1010.se
795540701 gbpln1011.se
776376885 gbpln1012.se
1448905128 gbpln1013.se
1457656304 gbpln1014.se
833009352 gbpln1015.se
797524540 gbpln1016.se
773297930 gbpln1017.se
1451244889 gbpln1018.se
1454193216 gbpln1019.se
1489362717 gbpln102.seq
830169429 gbpln1020.se
793310457 gbpln1021.se
773560290 gbpln1022.se
1446231891 gbpln1023.se
1450937303 gbpln1024.se
835938341 gbpln1025.se
795056321 gbpln1026.se
770765157 gbpln1027.se
1475561524 gbpln1028.se
1466579245 gbpln1029.se
1499092145 gbpln103.seq
829099164 gbpln1030.se
790989379 gbpln1031.se
773398673 gbpln1032.se
1462046272 gbpln1033.se
1449910042 gbpln1034.se
837413052 gbpln1035.se
790648527 gbpln1036.se
772176401 gbpln1037.se
1460620041 gbpln1038.se
1455765886 gbpln1039.se
1473551999 gbpln104.seq
833059054 gbpln1040.se
794545184 gbpln1041.se
774083177 gbpln1042.se
1448946753 gbpln1043.se
1458559584 gbpln1044.se
835451342 gbpln1045.se
794577233 gbpln1046.se
775251446 gbpln1047.se
1454531761 gbpln1048.se
1463618989 gbpln1049.se
1497683966 gbpln105.seq
836809812 gbpln1050.se
806584862 gbpln1051.se
776084155 gbpln1052.se
1485075661 gbpln1053.se
1448852265 gbpln1054.se
836125457 gbpln1055.se
794049612 gbpln1056.se
769729355 gbpln1057.se
1469601615 gbpln1058.se
1458361301 gbpln1059.se
1339792010 gbpln106.seq
840008504 gbpln1060.se
794029694 gbpln1061.se
769623341 gbpln1062.se
1477482614 gbpln1063.se
1456549528 gbpln1064.se
836931236 gbpln1065.se
792455888 gbpln1066.se
768695354 gbpln1067.se
1450909194 gbpln1068.se
1454926637 gbpln1069.se
946931884 gbpln107.seq
835570197 gbpln1070.se
798619346 gbpln1071.se
776375847 gbpln1072.se
1468212148 gbpln1073.se
1463519623 gbpln1074.se
832456199 gbpln1075.se
793920035 gbpln1076.se
773324985 gbpln1077.se
1443647684 gbpln1078.se
1458966967 gbpln1079.se
1121159029 gbpln108.seq
834886228 gbpln1080.se
792465315 gbpln1081.se
766375549 gbpln1082.se
1449349195 gbpln1083.se
1457671779 gbpln1084.se
836173230 gbpln1085.se
792990723 gbpln1086.se
774691916 gbpln1087.se
1452432506 gbpln1088.se
797342703 gbpln1089.se
1164001315 gbpln109.seq
1496638015 gbpln1090.se
804070482 gbpln1091.se
777569920 gbpln1092.se
1461158646 gbpln1093.se
1466754128 gbpln1094.se
830451601 gbpln1095.se
798616435 gbpln1096.se
774880678 gbpln1097.se
1455218535 gbpln1098.se
1460523331 gbpln1099.se
1408071661 gbpln11.seq
1483600477 gbpln110.seq
837230145 gbpln1100.se
796560308 gbpln1101.se
777015504 gbpln1102.se
1455593679 gbpln1103.se
1455711383 gbpln1104.se
838785071 gbpln1105.se
791233293 gbpln1106.se
770014685 gbpln1107.se
1450013191 gbpln1108.se
1455309450 gbpln1109.se
1314173387 gbpln111.seq
835677720 gbpln1110.se
793372574 gbpln1111.se
769401747 gbpln1112.se
1456544663 gbpln1113.se
1465313453 gbpln1114.se
839230685 gbpln1115.se
803963907 gbpln1116.se
778586682 gbpln1117.se
1463130395 gbpln1118.se
1457728697 gbpln1119.se
946518369 gbpln112.seq
832496071 gbpln1120.se
797513192 gbpln1121.se
776551156 gbpln1122.se
1449845840 gbpln1123.se
1460493739 gbpln1124.se
839860091 gbpln1125.se
789840368 gbpln1126.se
776969912 gbpln1127.se
1450486337 gbpln1128.se
1492412414 gbpln1129.se
1120694900 gbpln113.seq
1486347390 gbpln1130.se
1445734827 gbpln1131.se
1251330037 gbpln1132.se
1123381446 gbpln1133.se
1111693114 gbpln1134.se
1309334197 gbpln1135.se
1445887647 gbpln1136.se
1075129462 gbpln1137.se
830295693 gbpln1138.se
794035728 gbpln1139.se
1163541839 gbpln114.seq
766241777 gbpln1140.se
1451959155 gbpln1141.se
1460262157 gbpln1142.se
800420442 gbpln1143.se
807100878 gbpln1144.se
813165275 gbpln1145.se
1489858794 gbpln1146.se
1463645427 gbpln1147.se
836403024 gbpln1148.se
797704105 gbpln1149.se
1476382817 gbpln115.seq
771673145 gbpln1150.se
1489073756 gbpln1151.se
1463000631 gbpln1152.se
835021187 gbpln1153.se
794511065 gbpln1154.se
765022160 gbpln1155.se
1450430115 gbpln1156.se
1446394723 gbpln1157.se
837987830 gbpln1158.se
795104781 gbpln1159.se
1478729959 gbpln116.seq
772053911 gbpln1160.se
1454341387 gbpln1161.se
1471789737 gbpln1162.se
850377149 gbpln1163.se
1235921295 gbpln1164.se
820639220 gbpln1165.se
1480990953 gbpln1166.se
791663935 gbpln1167.se
942730875 gbpln1168.se
1413074394 gbpln1169.se
1479499564 gbpln117.seq
1271934713 gbpln1170.se
1485567802 gbpln1171.se
1184860474 gbpln1172.se
1227017136 gbpln1173.se
774219381 gbpln1174.se
1442415305 gbpln1175.se
1485783848 gbpln1176.se
1496789915 gbpln1177.se
1459198915 gbpln1178.se
990926845 gbpln1179.se
1440606987 gbpln118.seq
840478319 gbpln1180.se
804862544 gbpln1181.se
775136193 gbpln1182.se
1456887584 gbpln1183.se
1470716689 gbpln1184.se
836948259 gbpln1185.se
794972859 gbpln1186.se
775455598 gbpln1187.se
1463119445 gbpln1188.se
1451301195 gbpln1189.se
1456135485 gbpln119.seq
852997313 gbpln1190.se
798187575 gbpln1191.se
776406263 gbpln1192.se
1458385249 gbpln1193.se
1463826120 gbpln1194.se
833048862 gbpln1195.se
794071582 gbpln1196.se
772684697 gbpln1197.se
1454827832 gbpln1198.se
1451661085 gbpln1199.se
1475360853 gbpln12.seq
1463536478 gbpln120.seq
839152730 gbpln1200.se
798464996 gbpln1201.se
775710033 gbpln1202.se
1463986968 gbpln1203.se
1455516963 gbpln1204.se
827472017 gbpln1205.se
799696373 gbpln1206.se
771541363 gbpln1207.se
1456098533 gbpln1208.se
1450468258 gbpln1209.se
1456620390 gbpln121.seq
830011447 gbpln1210.se
803324869 gbpln1211.se
778613518 gbpln1212.se
1485535574 gbpln1213.se
1460285834 gbpln1214.se
834396522 gbpln1215.se
793156442 gbpln1216.se
771664945 gbpln1217.se
1460976066 gbpln1218.se
1472747650 gbpln1219.se
1460093363 gbpln122.seq
831402033 gbpln1220.se
788227480 gbpln1221.se
773608315 gbpln1222.se
1459251214 gbpln1223.se
1457115869 gbpln1224.se
833114761 gbpln1225.se
791988363 gbpln1226.se
773778680 gbpln1227.se
1439338108 gbpln1228.se
1459678216 gbpln1229.se
1463892432 gbpln123.seq
832582978 gbpln1230.se
790630518 gbpln1231.se
774554078 gbpln1232.se
1459431387 gbpln1233.se
1462622889 gbpln1234.se
841885928 gbpln1235.se
814740283 gbpln1236.se
781686950 gbpln1237.se
1470777020 gbpln1238.se
1474113031 gbpln1239.se
1473670733 gbpln124.seq
836345572 gbpln1240.se
803943397 gbpln1241.se
776352617 gbpln1242.se
1461742228 gbpln1243.se
1468260082 gbpln1244.se
833628952 gbpln1245.se
800337028 gbpln1246.se
775679569 gbpln1247.se
1485372410 gbpln1248.se
1470684487 gbpln1249.se
1482379607 gbpln125.seq
837791026 gbpln1250.se
805450455 gbpln1251.se
782697461 gbpln1252.se
1462403294 gbpln1253.se
1471545155 gbpln1254.se
844251896 gbpln1255.se
800661389 gbpln1256.se
770104661 gbpln1257.se
1486820730 gbpln1258.se
1437673274 gbpln1259.se
1476774928 gbpln126.seq
1478905630 gbpln1260.se
1484038098 gbpln1261.se
1459847462 gbpln1262.se
1419009936 gbpln1263.se
1449294852 gbpln1264.se
1432942330 gbpln1265.se
1483752514 gbpln1266.se
1440643664 gbpln1267.se
1404423649 gbpln1268.se
1444711390 gbpln1269.se
1455061244 gbpln127.seq
1488511554 gbpln1270.se
1472104928 gbpln1271.se
1252858539 gbpln1272.se
1227118965 gbpln1273.se
1253367586 gbpln1274.se
1312280922 gbpln1275.se
1221593375 gbpln1276.se
1480321489 gbpln1277.se
1413447705 gbpln1278.se
1469526349 gbpln1279.se
1468832405 gbpln128.seq
1268059309 gbpln1280.se
2734223096 gbpln1281.se
2727931901 gbpln1282.se
2720692598 gbpln1283.se
2732441076 gbpln1284.se
2733260927 gbpln1285.se
157556535 gbpln1286.se
2694271430 gbpln1287.se
2735442486 gbpln1288.se
2720859722 gbpln1289.se
1481405587 gbpln129.seq
2732011308 gbpln1290.se
2383529845 gbpln1291.se
2723191931 gbpln1292.se
2689474086 gbpln1293.se
2737751830 gbpln1294.se
2700210160 gbpln1295.se
2006289519 gbpln1296.se
2636141786 gbpln1297.se
2722875815 gbpln1298.se
2725415454 gbpln1299.se
1437976712 gbpln13.seq
1485256990 gbpln130.seq
2730393002 gbpln1300.se
1948886785 gbpln1301.se
2738131093 gbpln1302.se
2727379378 gbpln1303.se
2679871098 gbpln1304.se
2737685310 gbpln1305.se
786720890 gbpln1306.se
2727907345 gbpln1307.se
2657432129 gbpln1308.se
2735229991 gbpln1309.se
1466086962 gbpln131.seq
2728645371 gbpln1310.se
218791011 gbpln1311.se
2719617838 gbpln1312.se
2721885171 gbpln1313.se
2721092581 gbpln1314.se
2679558604 gbpln1315.se
181580803 gbpln1316.se
2722179116 gbpln1317.se
2736369220 gbpln1318.se
2726783046 gbpln1319.se
1342525082 gbpln132.seq
2440060122 gbpln1320.se
2736724965 gbpln1321.se
2696541624 gbpln1322.se
2737924301 gbpln1323.se
1979539878 gbpln1324.se
2731302183 gbpln1325.se
2702984894 gbpln1326.se
2732485324 gbpln1327.se
1906858977 gbpln1328.se
1333776538 gbpln1329.se
1449705074 gbpln133.seq
1481529082 gbpln1330.se
1126988286 gbpln1331.se
1310090641 gbpln1332.se
1319048578 gbpln1333.se
1215502439 gbpln1334.se
1273213184 gbpln1335.se
1439841247 gbpln1336.se
1291263007 gbpln1337.se
1286241557 gbpln1338.se
1294607816 gbpln1339.se
1498267007 gbpln134.seq
1298830856 gbpln1340.se
1179380341 gbpln1341.se
1227809389 gbpln1342.se
1347974809 gbpln1343.se
1227045645 gbpln1344.se
1241387178 gbpln1345.se
1321199139 gbpln1346.se
1307076096 gbpln1347.se
1194598426 gbpln1348.se
1267961203 gbpln1349.se
1476435886 gbpln135.seq
1465598311 gbpln1350.se
1272760531 gbpln1351.se
1248554044 gbpln1352.se
1285502181 gbpln1353.se
1353649948 gbpln1354.se
1201259963 gbpln1355.se
1114385426 gbpln1356.se
1428292861 gbpln1357.se
1254591123 gbpln1358.se
1109371533 gbpln1359.se
1451197736 gbpln136.seq
1256013571 gbpln1360.se
1193254570 gbpln1361.se
1147797532 gbpln1362.se
1185963587 gbpln1363.se
1176623547 gbpln1364.se
1184486862 gbpln1365.se
1178497787 gbpln1366.se
1255058840 gbpln1367.se
1121066110 gbpln1368.se
1150746117 gbpln1369.se
1438398494 gbpln137.seq
1179251584 gbpln1370.se
1319824235 gbpln1371.se
1194499724 gbpln1372.se
1150884296 gbpln1373.se
1260272463 gbpln1374.se
1277796253 gbpln1375.se
1077009674 gbpln1376.se
1159931138 gbpln1377.se
1298671968 gbpln1378.se
1092881836 gbpln1379.se
1449379606 gbpln138.seq
1120436749 gbpln1380.se
1214127482 gbpln1381.se
1117793566 gbpln1382.se
1019835843 gbpln1383.se
1155398206 gbpln1384.se
1368620545 gbpln1385.se
1144165985 gbpln1386.se
1072391985 gbpln1387.se
1263097017 gbpln1388.se
1297997059 gbpln1389.se
1454197352 gbpln139.seq
1325335044 gbpln1390.se
1216230084 gbpln1391.se
1263623363 gbpln1392.se
1174025244 gbpln1393.se
1229634718 gbpln1394.se
1363681878 gbpln1395.se
1218381112 gbpln1396.se
1400966271 gbpln1397.se
1382372150 gbpln1398.se
1176735774 gbpln1399.se
1499999030 gbpln14.seq
1499633326 gbpln140.seq
1224889930 gbpln1400.se
1310436934 gbpln1401.se
1233749942 gbpln1402.se
1059964644 gbpln1403.se
1254488223 gbpln1404.se
1310744622 gbpln1405.se
1163904965 gbpln1406.se
1264654503 gbpln1407.se
1296551517 gbpln1408.se
1158563945 gbpln1409.se
1367219690 gbpln141.seq
1059918971 gbpln1410.se
1259052983 gbpln1411.se
1206631634 gbpln1412.se
1106849019 gbpln1413.se
1193454949 gbpln1414.se
1254210685 gbpln1415.se
1151910983 gbpln1416.se
1118028517 gbpln1417.se
1136283639 gbpln1418.se
1270471759 gbpln1419.se
1028426203 gbpln142.seq
1106145822 gbpln1420.se
1237358153 gbpln1421.se
1388485833 gbpln1422.se
1221364282 gbpln1423.se
1101728075 gbpln1424.se
1191208317 gbpln1425.se
1212231259 gbpln1426.se
1132007157 gbpln1427.se
1441955987 gbpln1428.se
1470274017 gbpln1429.se
1251274347 gbpln143.seq
1459739391 gbpln1430.se
1471760010 gbpln1431.se
1440847993 gbpln1432.se
1455978021 gbpln1433.se
1445045468 gbpln1434.se
1487079619 gbpln1435.se
1481625137 gbpln1436.se
1447279971 gbpln1437.se
1048521841 gbpln1438.se
1038155649 gbpln1439.se
1453657951 gbpln144.seq
833369914 gbpln1440.se
931292853 gbpln1441.se
811379776 gbpln1442.se
1077992421 gbpln1443.se
812614241 gbpln1444.se
1052276437 gbpln1445.se
1035793500 gbpln1446.se
832863065 gbpln1447.se
922247149 gbpln1448.se
807661511 gbpln1449.se
1481017758 gbpln145.seq
1066166792 gbpln1450.se
997697986 gbpln1451.se
1273669998 gbpln1452.se
1102521608 gbpln1453.se
1209618371 gbpln1454.se
1111089963 gbpln1455.se
1160173863 gbpln1456.se
1205643923 gbpln1457.se
1237074429 gbpln1458.se
1242683281 gbpln1459.se
1498606076 gbpln146.seq
1080809951 gbpln1460.se
1226448377 gbpln1461.se
1349517074 gbpln1462.se
1175767295 gbpln1463.se
1216393612 gbpln1464.se
1294608106 gbpln1465.se
1298831146 gbpln1466.se
1179380631 gbpln1467.se
1227809679 gbpln1468.se
1347975099 gbpln1469.se
1442798465 gbpln147.seq
1227045935 gbpln1470.se
1241387663 gbpln1471.se
1256013573 gbpln1472.se
1193254572 gbpln1473.se
1147797534 gbpln1474.se
1185963589 gbpln1475.se
1176623549 gbpln1476.se
1184486864 gbpln1477.se
1178497789 gbpln1478.se
1255058842 gbpln1479.se
1457724171 gbpln148.seq
1121066112 gbpln1480.se
1150746119 gbpln1481.se
1179251586 gbpln1482.se
1319824237 gbpln1483.se
1194499726 gbpln1484.se
1150884349 gbpln1485.se
1183507690 gbpln1486.se
1165156001 gbpln1487.se
1145365871 gbpln1488.se
1114264316 gbpln1489.se
1479937021 gbpln149.seq
1291707339 gbpln1490.se
1200907808 gbpln1491.se
1185642828 gbpln1492.se
1268692726 gbpln1493.se
1272919740 gbpln1494.se
1103058293 gbpln1495.se
1122948169 gbpln1496.se
1380211964 gbpln1497.se
1129155752 gbpln1498.se
1160577179 gbpln1499.se
1498851513 gbpln15.seq
1491344801 gbpln150.seq
1260272465 gbpln1500.se
1277796255 gbpln1501.se
1077009676 gbpln1502.se
1159931140 gbpln1503.se
1298671970 gbpln1504.se
1092881838 gbpln1505.se
1120436751 gbpln1506.se
1214127484 gbpln1507.se
1117793568 gbpln1508.se
1019835845 gbpln1509.se
1495551806 gbpln151.seq
1155398208 gbpln1510.se
1368620547 gbpln1511.se
1144165987 gbpln1512.se
1072392038 gbpln1513.se
1310090643 gbpln1514.se
1319048580 gbpln1515.se
1215502441 gbpln1516.se
1273213186 gbpln1517.se
1439841249 gbpln1518.se
1291263009 gbpln1519.se
1492595295 gbpln152.seq
1286241610 gbpln1520.se
1263097019 gbpln1521.se
1297997061 gbpln1522.se
1325335047 gbpln1523.se
1216230086 gbpln1524.se
1263623365 gbpln1525.se
1174025246 gbpln1526.se
1229634720 gbpln1527.se
1363681880 gbpln1528.se
1218381114 gbpln1529.se
1475790089 gbpln153.seq
1400966274 gbpln1530.se
1382372152 gbpln1531.se
1176735776 gbpln1532.se
1259998472 gbpln1533.se
1429872810 gbpln1534.se
1290195552 gbpln1535.se
1118855412 gbpln1536.se
1286015571 gbpln1537.se
1309057752 gbpln1538.se
1189205456 gbpln1539.se
1477822066 gbpln154.seq
1088738989 gbpln1540.se
1310436046 gbpln1541.se
1233749054 gbpln1542.se
1059963756 gbpln1543.se
1254487335 gbpln1544.se
1310743734 gbpln1545.se
1233633287 gbpln1546.se
1257623330 gbpln1547.se
1136790411 gbpln1548.se
1024083293 gbpln1549.se
1462101378 gbpln155.seq
1208012116 gbpln1550.se
1341166334 gbpln1551.se
1178296123 gbpln1552.se
1133776595 gbpln1553.se
1321198791 gbpln1554.se
1307075748 gbpln1555.se
1194598078 gbpln1556.se
1267960855 gbpln1557.se
1465597963 gbpln1558.se
1272760183 gbpln1559.se
1497200933 gbpln156.seq
1248553572 gbpln1560.se
997697304 gbpln1561.se
1273669316 gbpln1562.se
1102520926 gbpln1563.se
1209617689 gbpln1564.se
1111089281 gbpln1565.se
1160173181 gbpln1566.se
1205643241 gbpln1567.se
1237073747 gbpln1568.se
1242682599 gbpln1569.se
1497415098 gbpln157.seq
1080809269 gbpln1570.se
1226447695 gbpln1571.se
1349516392 gbpln1572.se
1175766613 gbpln1573.se
1216392639 gbpln1574.se
1306535163 gbpln1575.se
1471600767 gbpln1576.se
1474480099 gbpln1577.se
1442648460 gbpln1578.se
1445144506 gbpln1579.se
1230413080 gbpln158.seq
1470808023 gbpln1580.se
1400146173 gbpln1581.se
1451194528 gbpln1582.se
1491931525 gbpln1583.se
1485075954 gbpln1584.se
1464218638 gbpln1585.se
1464354463 gbpln1586.se
1434708321 gbpln1587.se
1446304634 gbpln1588.se
1481913454 gbpln1589.se
847363052 gbpln159.seq
225362530 gbpln1590.se
2549738660 gbpln1591.se
1967027328 gbpln1592.se
1908341558 gbpln1593.se
1899626925 gbpln1594.se
1507440270 gbpln1595.se
1195338085 gbpln1596.se
1471685919 gbpln1597.se
1482476333 gbpln1598.se
1457504784 gbpln1599.se
1499242007 gbpln16.seq
1005396841 gbpln160.seq
1489313455 gbpln1600.se
1498865598 gbpln1601.se
997934006 gbpln1602.se
832020729 gbpln1603.se
803030138 gbpln1604.se
771628223 gbpln1605.se
1448711979 gbpln1606.se
1240387718 gbpln1607.se
1254120972 gbpln1608.se
1355940856 gbpln1609.se
963947636 gbpln161.seq
1218508495 gbpln1610.se
1405315859 gbpln1611.se
971627123 gbpln1612.se
850272715 gbpln1613.se
849609082 gbpln1614.se
850190924 gbpln1615.se
976829654 gbpln1616.se
814643125 gbpln1617.se
879514342 gbpln1618.se
812317704 gbpln1619.se
1459631632 gbpln162.seq
1488237027 gbpln1620.se
944480603 gbpln1621.se
1488070952 gbpln1622.se
1498634832 gbpln1623.se
1496264712 gbpln1624.se
1489792519 gbpln1625.se
1231600041 gbpln1626.se
1265330116 gbpln1627.se
1488619214 gbpln1628.se
1499817121 gbpln1629.se
748612126 gbpln163.seq
1330362587 gbpln1630.se
1240461713 gbpln1631.se
1332036329 gbpln1632.se
1277787876 gbpln1633.se
1478171319 gbpln1634.se
1308033872 gbpln1635.se
1388656433 gbpln1636.se
1443471168 gbpln1637.se
1413408953 gbpln1638.se
548537029 gbpln1639.se
952879187 gbpln164.seq
1225077527 gbpln1640.se
720006493 gbpln1641.se
919172194 gbpln1642.se
874099561 gbpln1643.se
897784196 gbpln1644.se
876816853 gbpln1645.se
928190368 gbpln1646.se
951802003 gbpln1647.se
824940722 gbpln1648.se
1489306195 gbpln1649.se
925770625 gbpln165.seq
1440059389 gbpln1650.se
1482809012 gbpln1651.se
1486345764 gbpln1652.se
1467102609 gbpln1653.se
1478834238 gbpln1654.se
1444208200 gbpln1655.se
1483418667 gbpln1656.se
1450848094 gbpln1657.se
1437771811 gbpln1658.se
1444812712 gbpln1659.se
679052523 gbpln166.seq
1488993344 gbpln1660.se
1446871084 gbpln1661.se
1494839831 gbpln1662.se
1496741541 gbpln1663.se
1374411960 gbpln1664.se
1182248477 gbpln1665.se
1497598741 gbpln1666.se
1491491345 gbpln1667.se
1461709979 gbpln1668.se
1449889995 gbpln1669.se
891360401 gbpln167.seq
1495849546 gbpln1670.se
1484634302 gbpln1671.se
1412074936 gbpln1672.se
1405761405 gbpln1673.se
1402453546 gbpln1674.se
1455644102 gbpln1675.se
1455814532 gbpln1676.se
1446114329 gbpln1677.se
1446417320 gbpln1678.se
917155014 gbpln1679.se
983898073 gbpln168.seq
1344094781 gbpln1680.se
1494221919 gbpln1681.se
1499592828 gbpln1682.se
1412833253 gbpln1683.se
1483609453 gbpln1684.se
1452520406 gbpln1685.se
1397047033 gbpln1686.se
1363158169 gbpln1687.se
1095290873 gbpln1688.se
1407629769 gbpln1689.se
816632077 gbpln169.seq
1485609248 gbpln1690.se
1473280517 gbpln1691.se
1395029086 gbpln1692.se
1294170668 gbpln1693.se
1429782007 gbpln1694.se
1449842921 gbpln1695.se
1191589738 gbpln1696.se
1497010592 gbpln1697.se
1315701164 gbpln1698.se
1281309867 gbpln1699.se
1499877669 gbpln17.seq
1120135193 gbpln170.seq
1464811778 gbpln1700.se
1494393829 gbpln1701.se
873807622 gbpln1702.se
1362396542 gbpln1703.se
1296127754 gbpln1704.se
1242755788 gbpln1705.se
1236451053 gbpln1706.se
1161997091 gbpln1707.se
1077269694 gbpln1708.se
1063032754 gbpln1709.se
972749686 gbpln171.seq
1035835981 gbpln1710.se
1035095313 gbpln1711.se
1031632940 gbpln1712.se
978747642 gbpln1713.se
979039775 gbpln1714.se
970029823 gbpln1715.se
965223462 gbpln1716.se
968357268 gbpln1717.se
1280849387 gbpln1718.se
1277873606 gbpln1719.se
850229174 gbpln172.seq
1033073499 gbpln1720.se
1255917596 gbpln1721.se
1033902901 gbpln1722.se
1338307356 gbpln1723.se
1253985607 gbpln1724.se
1211059423 gbpln1725.se
1165332095 gbpln1726.se
1473761940 gbpln1727.se
1478507707 gbpln1728.se
1406604626 gbpln1729.se
1055433660 gbpln173.seq
1497359305 gbpln1730.se
1498148324 gbpln1731.se
1470135810 gbpln1732.se
1271154552 gbpln1733.se
1449537429 gbpln1734.se
878967169 gbpln1735.se
1355240038 gbpln1736.se
1480516680 gbpln1737.se
1497401637 gbpln1738.se
1490481944 gbpln1739.se
1010018946 gbpln174.seq
1420494202 gbpln1740.se
1392744913 gbpln1741.se
1498251308 gbpln1742.se
1248523234 gbpln1743.se
1455420277 gbpln1744.se
1417475415 gbpln1745.se
1382790154 gbpln1746.se
1392095099 gbpln1747.se
1438579339 gbpln1748.se
1435206085 gbpln1749.se
649020564 gbpln175.seq
1438544862 gbpln1750.se
1473935428 gbpln1751.se
1447579761 gbpln1752.se
1397298339 gbpln1753.se
1202495428 gbpln1754.se
1159422590 gbpln1755.se
1142132932 gbpln1756.se
1041331622 gbpln1757.se
957152555 gbpln1758.se
1081839501 gbpln1759.se
926976142 gbpln176.seq
1445552919 gbpln1760.se
1319425564 gbpln1761.se
1268533720 gbpln1762.se
1109648066 gbpln1763.se
1486506812 gbpln1764.se
1497707315 gbpln1765.se
1422234672 gbpln1766.se
1489590944 gbpln1767.se
1478227947 gbpln1768.se
1402602326 gbpln1769.se
1429445258 gbpln177.seq
1491762551 gbpln1770.se
1484377526 gbpln1771.se
1397644911 gbpln1772.se
1489605217 gbpln1773.se
1479854682 gbpln1774.se
1498256062 gbpln1775.se
1461131200 gbpln1776.se
1042087100 gbpln1777.se
1112183793 gbpln1778.se
1489968340 gbpln1779.se
1395283641 gbpln178.seq
1244436981 gbpln1780.se
1433366576 gbpln1781.se
1476620950 gbpln1782.se
1383029421 gbpln1783.se
1407240135 gbpln1784.se
823995636 gbpln1785.se
779758590 gbpln1786.se
767138463 gbpln1787.se
1459415295 gbpln1788.se
1318422290 gbpln1789.se
1354945307 gbpln179.seq
809577106 gbpln1790.se
767635813 gbpln1791.se
1472481285 gbpln1792.se
1489014285 gbpln1793.se
1470984315 gbpln1794.se
783356383 gbpln1795.se
768556688 gbpln1796.se
1437743364 gbpln1797.se
1455697771 gbpln1798.se
827116263 gbpln1799.se
1492321788 gbpln18.seq
1483269401 gbpln180.seq
785947999 gbpln1800.se
765845200 gbpln1801.se
1449229608 gbpln1802.se
1406361789 gbpln1803.se
789953322 gbpln1804.se
1476310111 gbpln1805.se
1381424733 gbpln1806.se
1399187032 gbpln1807.se
828245843 gbpln1808.se
784946746 gbpln1809.se
1328920351 gbpln181.seq
762930721 gbpln1810.se
1442020097 gbpln1811.se
1446746274 gbpln1812.se
839668894 gbpln1813.se
780847594 gbpln1814.se
766352668 gbpln1815.se
1433384069 gbpln1816.se
1448399892 gbpln1817.se
830761006 gbpln1818.se
781576153 gbpln1819.se
1375810615 gbpln182.seq
770532847 gbpln1820.se
1451368039 gbpln1821.se
1456351185 gbpln1822.se
1469113773 gbpln1823.se
1493659421 gbpln1824.se
1334364137 gbpln1825.se
1341348990 gbpln1826.se
1487354963 gbpln1827.se
443688365 gbpln1828.se
1310990192 gbpln1829.se
1417059620 gbpln183.seq
936978374 gbpln1830.se
920269142 gbpln1831.se
883112886 gbpln1832.se
832543127 gbpln1833.se
1498857428 gbpln1834.se
1476584173 gbpln1835.se
952859598 gbpln1836.se
787766863 gbpln1837.se
1428004358 gbpln1838.se
755531660 gbpln1839.se
1445203849 gbpln184.seq
1480074698 gbpln1840.se
1469627882 gbpln1841.se
1183963878 gbpln1842.se
1240333955 gbpln1843.se
1318953961 gbpln1844.se
1188607975 gbpln1845.se
1366617485 gbpln1846.se
1335944846 gbpln1847.se
1266250426 gbpln1848.se
1452816684 gbpln1849.se
1390731093 gbpln185.seq
780043620 gbpln1850.se
905108798 gbpln1851.se
1382990824 gbpln1852.se
1232901940 gbpln1853.se
1440152635 gbpln1854.se
1168368744 gbpln1855.se
1199437811 gbpln1856.se
750909446 gbpln1857.se
1409079072 gbpln1858.se
1372624455 gbpln1859.se
1497962930 gbpln186.seq
1289743162 gbpln1860.se
1460859481 gbpln1861.se
790727412 gbpln1862.se
902368242 gbpln1863.se
1419211257 gbpln1864.se
1457101886 gbpln1865.se
1462888102 gbpln1866.se
994575943 gbpln1867.se
725493463 gbpln1868.se
868135626 gbpln1869.se
1456454745 gbpln187.seq
882846708 gbpln1870.se
797751492 gbpln1871.se
806424564 gbpln1872.se
733757147 gbpln1873.se
1451063550 gbpln1874.se
1188400824 gbpln1875.se
1492228313 gbpln1876.se
1494140034 gbpln1877.se
1489011845 gbpln1878.se
950702693 gbpln1879.se
1496680151 gbpln188.seq
883495278 gbpln1880.se
907591334 gbpln1881.se
810354788 gbpln1882.se
805672920 gbpln1883.se
742834347 gbpln1884.se
1485923593 gbpln1885.se
1499986349 gbpln1886.se
1478169462 gbpln1887.se
1488030531 gbpln1888.se
1492737370 gbpln1889.se
1420615749 gbpln189.seq
1463244561 gbpln1890.se
1456614467 gbpln1891.se
1459607920 gbpln1892.se
1445674110 gbpln1893.se
1461086753 gbpln1894.se
1481995846 gbpln1895.se
1460748247 gbpln1896.se
1430517997 gbpln1897.se
1413089596 gbpln1898.se
1270480418 gbpln1899.se
1498836627 gbpln19.seq
1482664385 gbpln190.seq
1141914292 gbpln1900.se
927866661 gbpln1901.se
1431042664 gbpln1902.se
1379009636 gbpln1903.se
1326487930 gbpln1904.se
1292059993 gbpln1905.se
1226033834 gbpln1906.se
1062596938 gbpln1907.se
887282416 gbpln1908.se
880396180 gbpln1909.se
1486398619 gbpln191.seq
1458441501 gbpln1910.se
1229011354 gbpln1911.se
1493749893 gbpln1912.se
1498429867 gbpln1913.se
1485955822 gbpln1914.se
1432654628 gbpln1915.se
1460754289 gbpln1916.se
1443249722 gbpln1917.se
1431829288 gbpln1918.se
1019856776 gbpln1919.se
1343267570 gbpln192.seq
926829963 gbpln1920.se
631978811 gbpln1921.se
1007025956 gbpln1922.se
1015784082 gbpln1923.se
849865988 gbpln1924.se
961335938 gbpln1925.se
1101841304 gbpln1926.se
807661531 gbpln1927.se
965168115 gbpln1928.se
876245218 gbpln1929.se
1439810163 gbpln193.seq
676215233 gbpln1930.se
908511369 gbpln1931.se
934941423 gbpln1932.se
737378330 gbpln1933.se
789038594 gbpln1934.se
944965471 gbpln1935.se
639676369 gbpln1936.se
956064578 gbpln1937.se
971671783 gbpln1938.se
1495611181 gbpln1939.se
1498345314 gbpln194.seq
1438689934 gbpln1940.se
1447349888 gbpln1941.se
1072443076 gbpln1942.se
1392610943 gbpln1943.se
1218955498 gbpln1944.se
1497279296 gbpln1945.se
1489661782 gbpln1946.se
1392066427 gbpln1947.se
1480523516 gbpln1948.se
1068870674 gbpln1949.se
1481520265 gbpln195.seq
1261901781 gbpln1950.se
1471965112 gbpln1951.se
1438337736 gbpln1952.se
1255789752 gbpln1953.se
1279146642 gbpln1954.se
1495918870 gbpln1955.se
1455909027 gbpln1956.se
1470157225 gbpln1957.se
1483914736 gbpln1958.se
1472108491 gbpln1959.se
1491852621 gbpln196.seq
1492057123 gbpln1960.se
1493036688 gbpln1961.se
1464769075 gbpln1962.se
1476005771 gbpln1963.se
1293680173 gbpln1964.se
1387843836 gbpln1965.se
1004253746 gbpln1966.se
825264608 gbpln1967.se
815981525 gbpln1968.se
1428426548 gbpln1969.se
1465440883 gbpln197.seq
1277942528 gbpln1970.se
845848353 gbpln1971.se
819614711 gbpln1972.se
799993345 gbpln1973.se
1406794313 gbpln1974.se
1499945207 gbpln1975.se
1499800682 gbpln1976.se
1113091232 gbpln1977.se
1495206239 gbpln198.seq
1491370074 gbpln199.seq
1499998956 gbpln2.seq
1493444162 gbpln20.seq
1494104955 gbpln200.seq
1491909258 gbpln201.seq
1479917236 gbpln202.seq
1481244025 gbpln203.seq
1470844609 gbpln204.seq
1483037018 gbpln205.seq
1499998575 gbpln206.seq
1500000035 gbpln207.seq
1500000019 gbpln208.seq
1303377262 gbpln209.seq
1461570444 gbpln21.seq
1442961212 gbpln210.seq
1432829714 gbpln211.seq
1493844141 gbpln212.seq
838266744 gbpln213.seq
786074578 gbpln214.seq
1469406697 gbpln215.seq
1351709444 gbpln216.seq
1499970874 gbpln217.seq
1499998384 gbpln218.seq
1499998814 gbpln219.seq
1405009495 gbpln22.seq
1499997265 gbpln220.seq
1499999224 gbpln221.seq
1499998588 gbpln222.seq
1499996630 gbpln223.seq
1491971139 gbpln224.seq
1458233530 gbpln225.seq
1495669145 gbpln226.seq
1483828883 gbpln227.seq
860028189 gbpln228.seq
800605872 gbpln229.seq
1410349024 gbpln23.seq
794469115 gbpln230.seq
1492903391 gbpln231.seq
1017558444 gbpln232.seq
924325157 gbpln233.seq
1201978654 gbpln234.seq
1227268207 gbpln235.seq
1152253241 gbpln236.seq
1115248374 gbpln237.seq
1125506105 gbpln238.seq
1145303472 gbpln239.seq
1486602472 gbpln24.seq
1497252257 gbpln240.seq
987259711 gbpln241.seq
689933987 gbpln242.seq
887561680 gbpln243.seq
834970472 gbpln244.seq
826391913 gbpln245.seq
792513917 gbpln246.seq
743209872 gbpln247.seq
1498927764 gbpln248.seq
860028189 gbpln249.seq
1447069404 gbpln25.seq
800605872 gbpln250.seq
794469115 gbpln251.seq
1492903391 gbpln252.seq
997390426 gbpln253.seq
663098252 gbpln254.seq
855592604 gbpln255.seq
807031053 gbpln256.seq
793905039 gbpln257.seq
1491456147 gbpln258.seq
1466632070 gbpln259.seq
1443978080 gbpln26.seq
840180304 gbpln260.seq
796430245 gbpln261.seq
779180715 gbpln262.seq
1486604510 gbpln263.seq
1445385427 gbpln264.seq
831209396 gbpln265.seq
783682955 gbpln266.seq
775938782 gbpln267.seq
1442399440 gbpln268.seq
1471877377 gbpln269.seq
1431713844 gbpln27.seq
872662143 gbpln270.seq
815663229 gbpln271.seq
813528167 gbpln272.seq
780491844 gbpln273.seq
734904793 gbpln274.seq
1451981137 gbpln275.seq
824184474 gbpln276.seq
768070182 gbpln277.seq
1491145948 gbpln278.seq
1472604409 gbpln279.seq
1433132237 gbpln28.seq
1481497172 gbpln280.seq
783385752 gbpln281.seq
770520351 gbpln282.seq
1452863252 gbpln283.seq
1486785182 gbpln284.seq
906907390 gbpln285.seq
844110716 gbpln286.seq
841780855 gbpln287.seq
805270043 gbpln288.seq
764396863 gbpln289.seq
1420175010 gbpln29.seq
841492595 gbpln290.seq
714482811 gbpln291.seq
916127997 gbpln292.seq
858459407 gbpln293.seq
848936990 gbpln294.seq
813129213 gbpln295.seq
765593150 gbpln296.seq
862731158 gbpln297.seq
665885634 gbpln298.seq
854365265 gbpln299.seq
1499949978 gbpln3.seq
1462499991 gbpln30.seq
802776346 gbpln300.seq
793295912 gbpln301.seq
1480158894 gbpln302.seq
1429544600 gbpln303.seq
814320946 gbpln304.seq
759349720 gbpln305.seq
1487159826 gbpln306.seq
1463992028 gbpln307.seq
684180819 gbpln308.seq
873292213 gbpln309.seq
1361699247 gbpln31.seq
827422505 gbpln310.seq
815925825 gbpln311.seq
779009585 gbpln312.seq
739747654 gbpln313.seq
1498046242 gbpln314.seq
849628701 gbpln315.seq
803882830 gbpln316.seq
794420470 gbpln317.seq
1474790996 gbpln318.seq
1469965572 gbpln319.seq
1405185513 gbpln32.seq
854770002 gbpln320.seq
805931576 gbpln321.seq
798923954 gbpln322.seq
1489544894 gbpln323.seq
1467528130 gbpln324.seq
854339916 gbpln325.seq
803900400 gbpln326.seq
791449620 gbpln327.seq
1476207543 gbpln328.seq
1475343864 gbpln329.seq
1469659294 gbpln33.seq
870939392 gbpln330.seq
809408813 gbpln331.seq
801514137 gbpln332.seq
1492438448 gbpln333.seq
1476330312 gbpln334.seq
846934671 gbpln335.seq
794708793 gbpln336.seq
789781753 gbpln337.seq
1475691254 gbpln338.seq
1489470879 gbpln339.seq
1463842015 gbpln34.seq
888406351 gbpln340.seq
835271741 gbpln341.seq
823533989 gbpln342.seq
787819193 gbpln343.seq
748786657 gbpln344.seq
1483648703 gbpln345.seq
1197559587 gbpln346.seq
898446949 gbpln347.seq
628489896 gbpln348.seq
1024113089 gbpln349.seq
1498027548 gbpln35.seq
1032878661 gbpln350.seq
858694781 gbpln351.seq
960391204 gbpln352.seq
1090094606 gbpln353.seq
781959143 gbpln354.seq
946995961 gbpln355.seq
857542781 gbpln356.seq
656405285 gbpln357.seq
907889097 gbpln358.seq
896386890 gbpln359.seq
1351882593 gbpln36.seq
726432335 gbpln360.seq
798296822 gbpln361.seq
918393750 gbpln362.seq
584961784 gbpln363.seq
948865971 gbpln364.seq
954536271 gbpln365.seq
819735731 gbpln366.seq
756588093 gbpln367.seq
876067119 gbpln368.seq
625446321 gbpln369.seq
1351800954 gbpln37.seq
977801494 gbpln370.seq
854357980 gbpln371.seq
807732556 gbpln372.seq
947696453 gbpln373.seq
1067629605 gbpln374.seq
822222048 gbpln375.seq
950272996 gbpln376.seq
1488985571 gbpln377.seq
894745096 gbpln378.seq
893352134 gbpln379.seq
1468650835 gbpln38.seq
1498806035 gbpln380.seq
1491810166 gbpln381.seq
933986451 gbpln382.seq
939527664 gbpln383.seq
810117922 gbpln384.seq
765938558 gbpln385.seq
886537018 gbpln386.seq
623519964 gbpln387.seq
996940649 gbpln388.seq
1030190034 gbpln389.seq
1469755843 gbpln39.seq
832828033 gbpln390.seq
956342979 gbpln391.seq
1134286144 gbpln392.seq
790513299 gbpln393.seq
944161893 gbpln394.seq
860035788 gbpln395.seq
647268685 gbpln396.seq
902239623 gbpln397.seq
1345936752 gbpln398.seq
787834228 gbpln399.seq
1484666191 gbpln4.seq
1497034040 gbpln40.seq
910724363 gbpln400.seq
606016896 gbpln401.seq
961485234 gbpln402.seq
1242775191 gbpln403.seq
1453328788 gbpln404.seq
818591771 gbpln405.seq
766580884 gbpln406.seq
1476620557 gbpln407.seq
1460693671 gbpln408.seq
750738544 gbpln409.seq
1492343636 gbpln41.seq
1496665003 gbpln410.seq
995069022 gbpln411.seq
1012956234 gbpln412.seq
827074347 gbpln413.seq
940621783 gbpln414.seq
1079418810 gbpln415.seq
776922106 gbpln416.seq
938380968 gbpln417.seq
1492330319 gbpln418.seq
891714442 gbpln419.seq
1499134618 gbpln42.seq
878638403 gbpln420.seq
721632671 gbpln421.seq
779156122 gbpln422.seq
895553446 gbpln423.seq
604678568 gbpln424.seq
931006295 gbpln425.seq
933660027 gbpln426.seq
810459540 gbpln427.seq
761872100 gbpln428.seq
878702815 gbpln429.seq
1497555328 gbpln43.seq
627081460 gbpln430.seq
994320235 gbpln431.seq
999434327 gbpln432.seq
823789349 gbpln433.seq
945629782 gbpln434.seq
1062113821 gbpln435.seq
792298939 gbpln436.seq
941851700 gbpln437.seq
850142413 gbpln438.seq
656955691 gbpln439.seq
1482367657 gbpln44.seq
904094753 gbpln440.seq
900193903 gbpln441.seq
1470079206 gbpln442.seq
1497721340 gbpln443.seq
937117048 gbpln444.seq
936021119 gbpln445.seq
812696702 gbpln446.seq
746628212 gbpln447.seq
897168807 gbpln448.seq
626698501 gbpln449.seq
1489311909 gbpln45.seq
1007072101 gbpln450.seq
1000831797 gbpln451.seq
841918855 gbpln452.seq
963426816 gbpln453.seq
1093654114 gbpln454.seq
791118382 gbpln455.seq
959940756 gbpln456.seq
853263842 gbpln457.seq
648051398 gbpln458.seq
901282075 gbpln459.seq
1445921549 gbpln46.seq
923491092 gbpln460.seq
732477869 gbpln461.seq
789987733 gbpln462.seq
926022053 gbpln463.seq
610840579 gbpln464.seq
949759032 gbpln465.seq
955444559 gbpln466.seq
818480442 gbpln467.seq
752251380 gbpln468.seq
897893149 gbpln469.seq
1443373575 gbpln47.seq
631111272 gbpln470.seq
1022032953 gbpln471.seq
1006306956 gbpln472.seq
837035085 gbpln473.seq
966140819 gbpln474.seq
1090560006 gbpln475.seq
800164754 gbpln476.seq
959884028 gbpln477.seq
886916735 gbpln478.seq
641540050 gbpln479.seq
1490715113 gbpln48.seq
910168783 gbpln480.seq
908785549 gbpln481.seq
729527181 gbpln482.seq
797552105 gbpln483.seq
910975470 gbpln484.seq
616026199 gbpln485.seq
945685366 gbpln486.seq
953145956 gbpln487.seq
820081609 gbpln488.seq
763165947 gbpln489.seq
1496764255 gbpln49.seq
1489098826 gbpln490.seq
1009123187 gbpln491.seq
1016689515 gbpln492.seq
832912303 gbpln493.seq
952656374 gbpln494.seq
1065835283 gbpln495.seq
776075044 gbpln496.seq
935940025 gbpln497.seq
1488231655 gbpln498.seq
1487557825 gbpln499.seq
1441569143 gbpln5.seq
1401573701 gbpln50.seq
720169483 gbpln500.seq
780564861 gbpln501.seq
1499144496 gbpln502.seq
934713391 gbpln503.seq
1233388213 gbpln504.seq
807542511 gbpln505.seq
757881986 gbpln506.seq
889760627 gbpln507.seq
635890046 gbpln508.seq
1007873898 gbpln509.seq
1447952617 gbpln51.seq
1015524558 gbpln510.seq
836625022 gbpln511.seq
959076059 gbpln512.seq
1077416379 gbpln513.seq
789416089 gbpln514.seq
958430056 gbpln515.seq
877922843 gbpln516.seq
648665455 gbpln517.seq
907513209 gbpln518.seq
904978028 gbpln519.seq
1491901767 gbpln52.seq
727024880 gbpln520.seq
789120540 gbpln521.seq
898507915 gbpln522.seq
617229811 gbpln523.seq
942711764 gbpln524.seq
964780021 gbpln525.seq
818917331 gbpln526.seq
755294557 gbpln527.seq
882064051 gbpln528.seq
627203691 gbpln529.seq
1393397092 gbpln53.seq
993595919 gbpln530.seq
1021497440 gbpln531.seq
827286497 gbpln532.seq
962451301 gbpln533.seq
1082256067 gbpln534.seq
781463827 gbpln535.seq
919665368 gbpln536.seq
1497522046 gbpln537.seq
905574854 gbpln538.seq
906714977 gbpln539.seq
1392232015 gbpln54.seq
718743537 gbpln540.seq
787529633 gbpln541.seq
910251919 gbpln542.seq
608518276 gbpln543.seq
934541265 gbpln544.seq
954054955 gbpln545.seq
806443717 gbpln546.seq
1009766480 gbpln547.seq
1318260463 gbpln548.seq
1253136609 gbpln549.seq
1266769227 gbpln55.seq
1066198175 gbpln550.seq
1119572655 gbpln551.seq
1040217505 gbpln552.seq
1310077288 gbpln553.seq
955690374 gbpln554.seq
1230684440 gbpln555.seq
1179787958 gbpln556.seq
1125383520 gbpln557.seq
1051194518 gbpln558.seq
965656648 gbpln559.seq
1499855395 gbpln56.seq
1363518112 gbpln560.seq
1497325995 gbpln561.seq
787261705 gbpln562.seq
773098599 gbpln563.seq
1456694585 gbpln564.seq
1200145527 gbpln565.seq
1449107426 gbpln566.seq
1445293778 gbpln567.seq
1219201533 gbpln568.seq
1281941476 gbpln569.seq
1450916819 gbpln57.seq
1485920790 gbpln570.seq
1322806126 gbpln571.seq
756143249 gbpln572.seq
878426054 gbpln573.seq
631056251 gbpln574.seq
993852367 gbpln575.seq
1020132695 gbpln576.seq
830166807 gbpln577.seq
955723315 gbpln578.seq
1057964328 gbpln579.seq
1364181618 gbpln58.seq
784007552 gbpln580.seq
947940191 gbpln581.seq
857511193 gbpln582.seq
649137171 gbpln583.seq
903393879 gbpln584.seq
908180396 gbpln585.seq
721135945 gbpln586.seq
786739709 gbpln587.seq
918070756 gbpln588.seq
603192844 gbpln589.seq
1446433546 gbpln59.seq
938102555 gbpln590.seq
955978436 gbpln591.seq
1498126933 gbpln592.seq
1395890363 gbpln593.seq
768159651 gbpln594.seq
891261263 gbpln595.seq
1017239134 gbpln596.seq
1036737053 gbpln597.seq
980587319 gbpln598.seq
1096962209 gbpln599.seq
1472320537 gbpln6.seq
1426285617 gbpln60.seq
964715275 gbpln600.seq
883795567 gbpln601.seq
879409471 gbpln602.seq
922242639 gbpln603.seq
805484043 gbpln604.seq
912391541 gbpln605.seq
954577618 gbpln606.seq
1499997878 gbpln607.seq
1499999885 gbpln608.seq
1499876372 gbpln609.seq
1491531429 gbpln61.seq
1499800215 gbpln610.seq
1499916531 gbpln611.seq
1499998853 gbpln612.seq
1500000039 gbpln613.seq
1499951500 gbpln614.seq
1499740939 gbpln615.seq
1499999208 gbpln616.seq
1499998948 gbpln617.seq
1499811435 gbpln618.seq
1499918755 gbpln619.seq
1453858827 gbpln62.seq
1453661748 gbpln620.seq
989247362 gbpln621.seq
865045961 gbpln622.seq
815791689 gbpln623.seq
802718902 gbpln624.seq
1497835829 gbpln625.seq
1489200818 gbpln626.seq
873797632 gbpln627.seq
820367220 gbpln628.seq
806296382 gbpln629.seq
1486495774 gbpln63.seq
775209384 gbpln630.seq
744231520 gbpln631.seq
817156402 gbpln632.seq
771380170 gbpln633.seq
913253142 gbpln634.seq
634934982 gbpln635.seq
1019175188 gbpln636.seq
1023638564 gbpln637.seq
822225605 gbpln638.seq
961290952 gbpln639.seq
1359730738 gbpln64.seq
1090804562 gbpln640.seq
813694518 gbpln641.seq
962545328 gbpln642.seq
873725319 gbpln643.seq
673190932 gbpln644.seq
905064826 gbpln645.seq
908590682 gbpln646.seq
742712720 gbpln647.seq
793279946 gbpln648.seq
934932909 gbpln649.seq
1263006379 gbpln65.seq
640700840 gbpln650.seq
961568346 gbpln651.seq
952066709 gbpln652.seq
1470907411 gbpln653.seq
1315696034 gbpln654.seq
1451561486 gbpln655.seq
1409767917 gbpln656.seq
1192999645 gbpln657.seq
1105379400 gbpln658.seq
1196658436 gbpln659.seq
1310203926 gbpln66.seq
1136119548 gbpln660.seq
1284507799 gbpln661.seq
1122567296 gbpln662.seq
1192074506 gbpln663.seq
1181896740 gbpln664.seq
1430814492 gbpln665.seq
858786663 gbpln666.seq
1482575758 gbpln667.seq
1256005171 gbpln668.seq
1249214474 gbpln669.seq
1462205110 gbpln67.seq
1164522681 gbpln670.seq
1002097666 gbpln671.seq
1300955592 gbpln672.seq
1317957634 gbpln673.seq
1148040939 gbpln674.seq
1403417765 gbpln675.seq
1375754075 gbpln676.seq
1327873437 gbpln677.seq
1281078332 gbpln678.seq
1383451324 gbpln679.seq
1425027582 gbpln68.seq
1300107704 gbpln680.seq
1290738490 gbpln681.seq
1459920083 gbpln682.seq
1006352199 gbpln683.seq
962815279 gbpln684.seq
975138624 gbpln685.seq
906550423 gbpln686.seq
790269619 gbpln687.seq
956926034 gbpln688.seq
908369814 gbpln689.seq
1169504271 gbpln69.seq
1035806383 gbpln690.seq
1095241384 gbpln691.seq
889046375 gbpln692.seq
920177986 gbpln693.seq
934896187 gbpln694.seq
972756494 gbpln695.seq
1478454737 gbpln696.seq
1479400215 gbpln697.seq
1382640922 gbpln698.seq
1372701817 gbpln699.seq
1486763485 gbpln7.seq
1497433984 gbpln70.seq
1490030230 gbpln700.seq
1296249908 gbpln701.seq
1454591651 gbpln702.seq
1470492456 gbpln703.seq
1449617617 gbpln704.seq
1223515912 gbpln705.seq
1372955396 gbpln706.seq
1437909873 gbpln707.seq
1307026425 gbpln708.seq
1462620068 gbpln709.seq
1483539734 gbpln71.seq
1466603356 gbpln710.seq
1073063047 gbpln711.seq
890586335 gbpln712.seq
628166165 gbpln713.seq
1008494769 gbpln714.seq
987228439 gbpln715.seq
843057145 gbpln716.seq
959088226 gbpln717.seq
1080118899 gbpln718.seq
790032688 gbpln719.seq
1318317824 gbpln72.seq
943744807 gbpln720.seq
858758922 gbpln721.seq
664109823 gbpln722.seq
920678547 gbpln723.seq
888501596 gbpln724.seq
739915903 gbpln725.seq
788736235 gbpln726.seq
944601114 gbpln727.seq
621465898 gbpln728.seq
948555730 gbpln729.seq
1495740283 gbpln73.seq
954911742 gbpln730.seq
854893096 gbpln731.seq
752395251 gbpln732.seq
890282441 gbpln733.seq
626588937 gbpln734.seq
1004358313 gbpln735.seq
1028945402 gbpln736.seq
838465030 gbpln737.seq
950517847 gbpln738.seq
1082441570 gbpln739.seq
1486223140 gbpln74.seq
789583361 gbpln740.seq
950035125 gbpln741.seq
853507173 gbpln742.seq
659807142 gbpln743.seq
902654821 gbpln744.seq
890952839 gbpln745.seq
721824594 gbpln746.seq
785634142 gbpln747.seq
909002040 gbpln748.seq
625532225 gbpln749.seq
1482059419 gbpln75.seq
945667284 gbpln750.seq
953425672 gbpln751.seq
871481110 gbpln752.seq
1254084023 gbpln753.seq
1125916060 gbpln754.seq
1182821230 gbpln755.seq
1211366567 gbpln756.seq
746226477 gbpln757.seq
808684469 gbpln758.seq
907082918 gbpln759.seq
1474577338 gbpln76.seq
776688264 gbpln760.seq
1492098096 gbpln761.seq
1287386861 gbpln762.seq
1186027473 gbpln763.seq
1009876518 gbpln764.seq
1484585650 gbpln765.seq
1144766377 gbpln766.seq
752395251 gbpln767.seq
890282441 gbpln768.seq
626588937 gbpln769.seq
1499887264 gbpln77.seq
1004358313 gbpln770.seq
1028945402 gbpln771.seq
838465030 gbpln772.seq
950517847 gbpln773.seq
1082441570 gbpln774.seq
789583361 gbpln775.seq
950035125 gbpln776.seq
853507173 gbpln777.seq
659807142 gbpln778.seq
902654821 gbpln779.seq
1458961713 gbpln78.seq
890952839 gbpln780.seq
721824594 gbpln781.seq
785634142 gbpln782.seq
909002040 gbpln783.seq
625532225 gbpln784.seq
945667284 gbpln785.seq
953425672 gbpln786.seq
1496387862 gbpln787.seq
660302915 gbpln788.seq
841140962 gbpln789.seq
1355968067 gbpln79.seq
1479991498 gbpln790.seq
1471774772 gbpln791.seq
1471086933 gbpln792.seq
1484902160 gbpln793.seq
1468998773 gbpln794.seq
1490807609 gbpln795.seq
1479849438 gbpln796.seq
1498136456 gbpln797.seq
1470643875 gbpln798.seq
1445523370 gbpln799.seq
1422472053 gbpln8.seq
1495723061 gbpln80.seq
1467112589 gbpln800.seq
1473756313 gbpln801.seq
1466744416 gbpln802.seq
1445506294 gbpln803.seq
1405467369 gbpln804.seq
1440178564 gbpln805.seq
1419442824 gbpln806.seq
1343657241 gbpln807.seq
1368729073 gbpln808.seq
1441459202 gbpln809.seq
1499303937 gbpln81.seq
1481187930 gbpln810.seq
1441199233 gbpln811.seq
1400519486 gbpln812.seq
1484052531 gbpln813.seq
1375272527 gbpln814.seq
898515699 gbpln815.seq
632798067 gbpln816.seq
1008257788 gbpln817.seq
1024893842 gbpln818.seq
849343522 gbpln819.seq
1462036884 gbpln82.seq
961475221 gbpln820.seq
1105698152 gbpln821.seq
806976195 gbpln822.seq
970150207 gbpln823.seq
872155147 gbpln824.seq
676154305 gbpln825.seq
905516657 gbpln826.seq
922918714 gbpln827.seq
742368796 gbpln828.seq
788401309 gbpln829.seq
1497562409 gbpln83.seq
929538814 gbpln830.seq
641895880 gbpln831.seq
961976329 gbpln832.seq
973033562 gbpln833.seq
834845430 gbpln834.seq
1096228945 gbpln835.seq
1065747701 gbpln836.seq
978382753 gbpln837.seq
970377845 gbpln838.seq
932157797 gbpln839.seq
1429503404 gbpln84.seq
878151180 gbpln840.seq
874085481 gbpln841.seq
829265282 gbpln842.seq
863296712 gbpln843.seq
823515696 gbpln844.seq
815413878 gbpln845.seq
1384284611 gbpln846.seq
1351462558 gbpln847.seq
1230738646 gbpln848.seq
541733671 gbpln849.seq
1429294583 gbpln85.seq
2012725364 gbpln850.seq
2313576156 gbpln851.seq
2199353950 gbpln852.seq
2096617948 gbpln853.seq
2106642320 gbpln854.seq
1745413839 gbpln855.seq
1943630373 gbpln856.seq
1096169796 gbpln857.seq
836152673 gbpln858.seq
790234194 gbpln859.seq
1435224119 gbpln86.seq
768134126 gbpln860.seq
1464177021 gbpln861.seq
1454383718 gbpln862.seq
839765734 gbpln863.seq
794136795 gbpln864.seq
777214951 gbpln865.seq
1459963687 gbpln866.seq
1453910479 gbpln867.seq
831555004 gbpln868.seq
787385081 gbpln869.seq
1441901118 gbpln87.seq
774061568 gbpln870.seq
1444041489 gbpln871.seq
1462025010 gbpln872.seq
837904862 gbpln873.seq
793009108 gbpln874.seq
770582515 gbpln875.seq
1458992600 gbpln876.seq
1472670481 gbpln877.seq
837974598 gbpln878.seq
802983165 gbpln879.seq
1438036013 gbpln88.seq
776399714 gbpln880.seq
1452076153 gbpln881.seq
1467682458 gbpln882.seq
841987686 gbpln883.seq
800255273 gbpln884.seq
776782162 gbpln885.seq
765490377 gbpln886.seq
737409430 gbpln887.seq
1467554404 gbpln888.seq
838067528 gbpln889.seq
1448827154 gbpln89.seq
794050154 gbpln890.seq
769006556 gbpln891.seq
1456537014 gbpln892.seq
1456423618 gbpln893.seq
831709069 gbpln894.seq
788018841 gbpln895.seq
776335168 gbpln896.seq
1447227789 gbpln897.seq
1462058949 gbpln898.seq
831948387 gbpln899.seq
1201022408 gbpln9.seq
1463103573 gbpln90.seq
792155197 gbpln900.seq
764395261 gbpln901.seq
1469026352 gbpln902.seq
1457035184 gbpln903.seq
832913530 gbpln904.seq
783381752 gbpln905.seq
777226067 gbpln906.seq
1449010172 gbpln907.seq
1460033796 gbpln908.seq
856583955 gbpln909.seq
1464662794 gbpln91.seq
800941651 gbpln910.seq
764839741 gbpln911.seq
1463437686 gbpln912.seq
1457211427 gbpln913.seq
838548262 gbpln914.seq
802434968 gbpln915.seq
775426579 gbpln916.seq
1468251987 gbpln917.seq
1456996279 gbpln918.seq
836584180 gbpln919.seq
927328060 gbpln92.seq
794556423 gbpln920.seq
763379902 gbpln921.seq
1472540375 gbpln922.seq
1467456048 gbpln923.seq
841588737 gbpln924.seq
793586133 gbpln925.seq
774193866 gbpln926.seq
1483592340 gbpln927.seq
1464730710 gbpln928.seq
832767207 gbpln929.seq
1444815761 gbpln93.seq
787519847 gbpln930.seq
773580778 gbpln931.seq
1453968537 gbpln932.seq
1458876981 gbpln933.seq
836647345 gbpln934.seq
804025438 gbpln935.seq
780287537 gbpln936.seq
1456910351 gbpln937.seq
1461116471 gbpln938.seq
847868245 gbpln939.seq
744339770 gbpln94.seq
799503371 gbpln940.seq
769858205 gbpln941.seq
1451384310 gbpln942.seq
1448178188 gbpln943.seq
841182040 gbpln944.seq
790643457 gbpln945.seq
771991395 gbpln946.seq
1449905950 gbpln947.seq
799948093 gbpln948.seq
836052022 gbpln949.seq
840483635 gbpln95.seq
791807902 gbpln950.seq
771195580 gbpln951.seq
1452626436 gbpln952.seq
1452862184 gbpln953.seq
666670553 gbpln954.seq
841954476 gbpln955.seq
801058907 gbpln956.seq
777293272 gbpln957.seq
1485779605 gbpln958.seq
1452913122 gbpln959.seq
1482268557 gbpln96.seq
836617454 gbpln960.seq
790837079 gbpln961.seq
777459210 gbpln962.seq
1453527109 gbpln963.seq
1454781569 gbpln964.seq
839842770 gbpln965.seq
793797445 gbpln966.seq
776363694 gbpln967.seq
1456772381 gbpln968.seq
1466569983 gbpln969.seq
1445216053 gbpln97.seq
845148875 gbpln970.seq
804833074 gbpln971.seq
778470839 gbpln972.seq
1481006670 gbpln973.seq
1474068832 gbpln974.seq
794180239 gbpln975.seq
774312132 gbpln976.seq
1457303714 gbpln977.seq
835115957 gbpln978.seq
1457626964 gbpln979.seq
1499019777 gbpln98.seq
836718375 gbpln980.seq
801816183 gbpln981.seq
780710756 gbpln982.seq
1487855625 gbpln983.seq
1468374097 gbpln984.seq
835020954 gbpln985.seq
794498287 gbpln986.seq
775035873 gbpln987.seq
1474921681 gbpln988.seq
1459702204 gbpln989.seq
1471007440 gbpln99.seq
836763143 gbpln990.seq
794319484 gbpln991.seq
771563217 gbpln992.seq
1442336041 gbpln993.seq
1461924552 gbpln994.seq
835744192 gbpln995.seq
793808493 gbpln996.seq
775366858 gbpln997.seq
1452650569 gbpln998.seq
1461461119 gbpln999.seq
1499992998 gbpri1.seq
1394043154 gbpri10.seq
1495964572 gbpri100.seq
1318392032 gbpri101.seq
1355571629 gbpri102.seq
1445745824 gbpri103.seq
1442671889 gbpri104.seq
1493536509 gbpri105.seq
1403137257 gbpri106.seq
1444919461 gbpri107.seq
1410522937 gbpri108.seq
1451687101 gbpri109.seq
1308233895 gbpri11.seq
1408933533 gbpri110.seq
1456495937 gbpri111.seq
1387816181 gbpri112.seq
1404931846 gbpri113.seq
1432578708 gbpri114.seq
1405440011 gbpri115.seq
1338627748 gbpri116.seq
1340905028 gbpri117.seq
1453101243 gbpri118.seq
1324362889 gbpri119.seq
1352591724 gbpri12.seq
1324397641 gbpri120.seq
1408571537 gbpri121.seq
1275737568 gbpri122.seq
1421464150 gbpri123.seq
1495167941 gbpri124.seq
1455208542 gbpri125.seq
1403991861 gbpri126.seq
1446257073 gbpri127.seq
1384095134 gbpri128.seq
1445278199 gbpri129.seq
1495555692 gbpri13.seq
1293353386 gbpri130.seq
1433367948 gbpri131.seq
1395378867 gbpri132.seq
1276602476 gbpri133.seq
1438054241 gbpri134.seq
1467541000 gbpri135.seq
1320863092 gbpri136.seq
1456536651 gbpri137.seq
1466610863 gbpri138.seq
1359780806 gbpri139.seq
1402237462 gbpri14.seq
1499943067 gbpri140.seq
1475693129 gbpri141.seq
1260750539 gbpri142.seq
1495098301 gbpri143.seq
1238904125 gbpri144.seq
1242283958 gbpri145.seq
1479001314 gbpri146.seq
1432304969 gbpri147.seq
1492676945 gbpri148.seq
1476290353 gbpri149.seq
1487902997 gbpri15.seq
1442607100 gbpri150.seq
1456981003 gbpri151.seq
1443625247 gbpri152.seq
1400092576 gbpri153.seq
1345137226 gbpri154.seq
1373185934 gbpri155.seq
1434010548 gbpri156.seq
1490297845 gbpri157.seq
1429267901 gbpri158.seq
1484585056 gbpri159.seq
1347857626 gbpri16.seq
1420880036 gbpri160.seq
1285024893 gbpri161.seq
1370173209 gbpri162.seq
1496306681 gbpri163.seq
1450180646 gbpri164.seq
1341467614 gbpri165.seq
1387332345 gbpri166.seq
1470704693 gbpri167.seq
1354403503 gbpri168.seq
1344504790 gbpri169.seq
1491380503 gbpri17.seq
1462427536 gbpri170.seq
1432074004 gbpri171.seq
1333079314 gbpri172.seq
1466026810 gbpri173.seq
1446816413 gbpri174.seq
1384264132 gbpri175.seq
1458853763 gbpri176.seq
1457412745 gbpri177.seq
1364294010 gbpri178.seq
1401919613 gbpri179.seq
1397668469 gbpri18.seq
1348141524 gbpri180.seq
1422975046 gbpri181.seq
1485417814 gbpri182.seq
1476689128 gbpri183.seq
1397626924 gbpri184.seq
1498120792 gbpri185.seq
1387697250 gbpri186.seq
1416144227 gbpri187.seq
1452703693 gbpri188.seq
1407035473 gbpri189.seq
1369669627 gbpri19.seq
1288712580 gbpri190.seq
1248506113 gbpri191.seq
1364854184 gbpri192.seq
1479558812 gbpri193.seq
1366753503 gbpri194.seq
1489166909 gbpri195.seq
1415801198 gbpri196.seq
1384022664 gbpri197.seq
1434572298 gbpri198.seq
1381901910 gbpri199.seq
1499865965 gbpri2.seq
1439722114 gbpri20.seq
1439604557 gbpri200.seq
1405041057 gbpri201.seq
1483127194 gbpri202.seq
1380666928 gbpri203.seq
1470392437 gbpri204.seq
1487830678 gbpri205.seq
1434611604 gbpri206.seq
1456507913 gbpri207.seq
1404327410 gbpri208.seq
1478530987 gbpri209.seq
1500000026 gbpri21.seq
1216965101 gbpri210.seq
1446664469 gbpri211.seq
1423350776 gbpri212.seq
1494349874 gbpri213.seq
1462051519 gbpri214.seq
1487459860 gbpri215.seq
1346932542 gbpri216.seq
1435992514 gbpri217.seq
1471040937 gbpri218.seq
1411620583 gbpri219.seq
1499980187 gbpri22.seq
1484773618 gbpri220.seq
1346264468 gbpri221.seq
1341625721 gbpri222.seq
1396369090 gbpri223.seq
1400881270 gbpri224.seq
1340397469 gbpri225.seq
1438615217 gbpri226.seq
1325442546 gbpri227.seq
1351884774 gbpri228.seq
1453347110 gbpri229.seq
1433910423 gbpri23.seq
1476115506 gbpri230.seq
1364420628 gbpri231.seq
1472683653 gbpri232.seq
1471719526 gbpri233.seq
1426931843 gbpri234.seq
1473415294 gbpri235.seq
1433692077 gbpri236.seq
1419022466 gbpri237.seq
1462223561 gbpri238.seq
1281714719 gbpri239.seq
1493422797 gbpri24.seq
1459018558 gbpri240.seq
1384280699 gbpri241.seq
1371120703 gbpri242.seq
1466988530 gbpri243.seq
1499909991 gbpri244.seq
1421428560 gbpri245.seq
1498574461 gbpri246.seq
1460703428 gbpri247.seq
1470716420 gbpri248.seq
1433800361 gbpri249.seq
1489213701 gbpri25.seq
1480017837 gbpri250.seq
1376936902 gbpri251.seq
1400467397 gbpri252.seq
1475236263 gbpri253.seq
1496630249 gbpri254.seq
1468620991 gbpri255.seq
1474162791 gbpri256.seq
1396104189 gbpri257.seq
1346586479 gbpri258.seq
1347952902 gbpri259.seq
1493262066 gbpri26.seq
1298764233 gbpri260.seq
1427293566 gbpri261.seq
1494008872 gbpri262.seq
1470822249 gbpri263.seq
1419747378 gbpri264.seq
1464271928 gbpri265.seq
1450721835 gbpri266.seq
1396794441 gbpri267.seq
1499094281 gbpri268.seq
1462020778 gbpri269.seq
1407053883 gbpri27.seq
1456716634 gbpri270.seq
1423150660 gbpri271.seq
1334733868 gbpri272.seq
1477093306 gbpri273.seq
1401382229 gbpri274.seq
1344819957 gbpri275.seq
1335018581 gbpri276.seq
1393585317 gbpri277.seq
1492681989 gbpri278.seq
1394057394 gbpri279.seq
1441456060 gbpri28.seq
1306374829 gbpri280.seq
1459492320 gbpri281.seq
1283178271 gbpri282.seq
1394896273 gbpri283.seq
1413425043 gbpri284.seq
1411752861 gbpri285.seq
1458158066 gbpri286.seq
1447911944 gbpri287.seq
1416279069 gbpri288.seq
1354359649 gbpri289.seq
1380240636 gbpri29.seq
1335473768 gbpri290.seq
1477859325 gbpri291.seq
1444661086 gbpri292.seq
1220138079 gbpri293.seq
1454577601 gbpri294.seq
1318715138 gbpri295.seq
1387096617 gbpri296.seq
1386291267 gbpri297.seq
1285515157 gbpri298.seq
1381683190 gbpri299.seq
1499835984 gbpri3.seq
1416177736 gbpri30.seq
1315306325 gbpri300.seq
1344125998 gbpri301.seq
1479620330 gbpri302.seq
1397358101 gbpri303.seq
1380192545 gbpri304.seq
1351740135 gbpri305.seq
1389255921 gbpri306.seq
1454933355 gbpri307.seq
1483361280 gbpri308.seq
1487165286 gbpri309.seq
1449889074 gbpri31.seq
1483238733 gbpri310.seq
1437384214 gbpri311.seq
1449717924 gbpri312.seq
1347588235 gbpri313.seq
1454975982 gbpri314.seq
1420356842 gbpri315.seq
1298170956 gbpri316.seq
1423364495 gbpri317.seq
1446686181 gbpri318.seq
1382434322 gbpri319.seq
1490919852 gbpri32.seq
1336368762 gbpri320.seq
1465383649 gbpri321.seq
1484781680 gbpri322.seq
1443957160 gbpri323.seq
1454606590 gbpri324.seq
1469781588 gbpri325.seq
1450937924 gbpri326.seq
1394994063 gbpri327.seq
1406591232 gbpri328.seq
1357023920 gbpri329.seq
1466190397 gbpri33.seq
1427953248 gbpri330.seq
1447872000 gbpri331.seq
1338229282 gbpri332.seq
1403835377 gbpri333.seq
1429580186 gbpri334.seq
1248333550 gbpri335.seq
1402508561 gbpri336.seq
1422378175 gbpri337.seq
1452195282 gbpri338.seq
1305786268 gbpri339.seq
1440000495 gbpri34.seq
1499725723 gbpri340.seq
1491467888 gbpri341.seq
1430438158 gbpri342.seq
1460937361 gbpri343.seq
1465691916 gbpri344.seq
1497771895 gbpri345.seq
1404242887 gbpri346.seq
1450577537 gbpri347.seq
1392382627 gbpri348.seq
1432052149 gbpri349.seq
1299250150 gbpri35.seq
1334212373 gbpri350.seq
1429020982 gbpri351.seq
1423811698 gbpri352.seq
1384476752 gbpri353.seq
1376938780 gbpri354.seq
1315743817 gbpri355.seq
1296914866 gbpri356.seq
1375431616 gbpri357.seq
1499104053 gbpri358.seq
1337266903 gbpri359.seq
1441505962 gbpri36.seq
1387658377 gbpri360.seq
1447004941 gbpri361.seq
1428215933 gbpri362.seq
1356652960 gbpri363.seq
1450829410 gbpri364.seq
1334734998 gbpri365.seq
1204021778 gbpri366.seq
1242592154 gbpri367.seq
1428199143 gbpri368.seq
1315803328 gbpri369.seq
1442377437 gbpri37.seq
1482804994 gbpri370.seq
1476541419 gbpri371.seq
1332772828 gbpri372.seq
1348388802 gbpri373.seq
1317135705 gbpri374.seq
1471839736 gbpri375.seq
1349875606 gbpri376.seq
1449336746 gbpri377.seq
1481089824 gbpri378.seq
1452204000 gbpri379.seq
1454058016 gbpri38.seq
1433019350 gbpri380.seq
1405902907 gbpri381.seq
1430080558 gbpri382.seq
1485814493 gbpri383.seq
1481394732 gbpri384.seq
1493952422 gbpri385.seq
1483650864 gbpri386.seq
1498174621 gbpri387.seq
1332498510 gbpri388.seq
1492344318 gbpri389.seq
1499749892 gbpri39.seq
1344939899 gbpri390.seq
1374624317 gbpri391.seq
1489875387 gbpri392.seq
1437646849 gbpri393.seq
1485043933 gbpri394.seq
1485744358 gbpri395.seq
1492874798 gbpri396.seq
1482252028 gbpri397.seq
1439310195 gbpri398.seq
1482378168 gbpri399.seq
1499966483 gbpri4.seq
1436112761 gbpri40.seq
1499242761 gbpri400.seq
1442385277 gbpri401.seq
1399203187 gbpri402.seq
1469910956 gbpri403.seq
1444342128 gbpri404.seq
1452739846 gbpri405.seq
1499355586 gbpri406.seq
1489531864 gbpri407.seq
1499124071 gbpri408.seq
1398185797 gbpri409.seq
1447805077 gbpri41.seq
1484387503 gbpri410.seq
1463231009 gbpri411.seq
1462310583 gbpri412.seq
1492396590 gbpri413.seq
1422294696 gbpri414.seq
1485131116 gbpri415.seq
1446691494 gbpri416.seq
1450290362 gbpri417.seq
1493916949 gbpri418.seq
1400353287 gbpri419.seq
1469953918 gbpri42.seq
1436356154 gbpri420.seq
1494870306 gbpri421.seq
1478354423 gbpri422.seq
1489520482 gbpri423.seq
1450655713 gbpri424.seq
1495820714 gbpri425.seq
1493735476 gbpri426.seq
1498619752 gbpri427.seq
1491875632 gbpri428.seq
1497685449 gbpri429.seq
1339666235 gbpri43.seq
1460652003 gbpri430.seq
1458781711 gbpri431.seq
1448622684 gbpri432.seq
1379265128 gbpri433.seq
1485291162 gbpri434.seq
1429631124 gbpri435.seq
1421359972 gbpri436.seq
1479107154 gbpri437.seq
1477232500 gbpri438.seq
1494815850 gbpri439.seq
1445286112 gbpri44.seq
1475640926 gbpri440.seq
1495435072 gbpri441.seq
1499853000 gbpri442.seq
1453600199 gbpri443.seq
1449675356 gbpri444.seq
1441802866 gbpri445.seq
1459507426 gbpri446.seq
1499899011 gbpri447.seq
1422394893 gbpri448.seq
1488584120 gbpri449.seq
1458190513 gbpri45.seq
1366139865 gbpri450.seq
1489791401 gbpri451.seq
1429504375 gbpri452.seq
1494493572 gbpri453.seq
1459477896 gbpri454.seq
1499861206 gbpri455.seq
1478968579 gbpri456.seq
1383168329 gbpri457.seq
1490208533 gbpri458.seq
1481469183 gbpri459.seq
1496305448 gbpri46.seq
1487358118 gbpri460.seq
1418280729 gbpri461.seq
1469473522 gbpri462.seq
1475609586 gbpri463.seq
1483950167 gbpri464.seq
1498266223 gbpri465.seq
1481885255 gbpri466.seq
1455217837 gbpri467.seq
1499971714 gbpri468.seq
1470603011 gbpri469.seq
1486466591 gbpri47.seq
1490055628 gbpri470.seq
1487820198 gbpri471.seq
1492122670 gbpri472.seq
1499621014 gbpri473.seq
1392665956 gbpri474.seq
1497966034 gbpri475.seq
1407245725 gbpri476.seq
1494936297 gbpri477.seq
1464587120 gbpri478.seq
1489388730 gbpri479.seq
1499237528 gbpri48.seq
1453664132 gbpri480.seq
1469874871 gbpri481.seq
1485936595 gbpri482.seq
1464835790 gbpri483.seq
1372581275 gbpri484.seq
1299804542 gbpri485.seq
1498843546 gbpri486.seq
1408871474 gbpri487.seq
1425713151 gbpri488.seq
1438590915 gbpri489.seq
1478814770 gbpri49.seq
1382106129 gbpri490.seq
1464637518 gbpri491.seq
1471163774 gbpri492.seq
1442864381 gbpri493.seq
1497298252 gbpri494.seq
1475522136 gbpri495.seq
1479264018 gbpri496.seq
1455146899 gbpri497.seq
1464226394 gbpri498.seq
1486631211 gbpri499.seq
1499769581 gbpri5.seq
1226472415 gbpri50.seq
1473480932 gbpri500.seq
1458695948 gbpri501.seq
1494522166 gbpri502.seq
1454977289 gbpri503.seq
1437991993 gbpri504.seq
1412405226 gbpri505.seq
1463354391 gbpri506.seq
1498494333 gbpri507.seq
1475240191 gbpri508.seq
1473139012 gbpri509.seq
1410747376 gbpri51.seq
1385796031 gbpri510.seq
1421911234 gbpri511.seq
1481060464 gbpri512.seq
1478696369 gbpri513.seq
1479338477 gbpri514.seq
1498211811 gbpri515.seq
1482951586 gbpri516.seq
1494526720 gbpri517.seq
1431030255 gbpri518.seq
1454888822 gbpri519.seq
1373045505 gbpri52.seq
1485236484 gbpri520.seq
1430456405 gbpri521.seq
1455322553 gbpri522.seq
1416195512 gbpri523.seq
1354257429 gbpri524.seq
1467014700 gbpri525.seq
1493520053 gbpri526.seq
1436826054 gbpri527.seq
1499646865 gbpri528.seq
1489056492 gbpri529.seq
1208942574 gbpri53.seq
1484611944 gbpri530.seq
1453792366 gbpri531.seq
1499828025 gbpri532.seq
1481212036 gbpri533.seq
1454546463 gbpri534.seq
1449525084 gbpri535.seq
1494861403 gbpri536.seq
1473073758 gbpri537.seq
1486637996 gbpri538.seq
1497524132 gbpri539.seq
1492722199 gbpri54.seq
1478472937 gbpri540.seq
1491661481 gbpri541.seq
1455424594 gbpri542.seq
1455410131 gbpri543.seq
1486798120 gbpri544.seq
1441337577 gbpri545.seq
1483251288 gbpri546.seq
1441475428 gbpri547.seq
1403877591 gbpri548.seq
1495708282 gbpri549.seq
1397228467 gbpri55.seq
1443829319 gbpri550.seq
1458144264 gbpri551.seq
1461166920 gbpri552.seq
1456151937 gbpri553.seq
1496379177 gbpri554.seq
1437126770 gbpri555.seq
1485094045 gbpri556.seq
1453438439 gbpri557.seq
1474474081 gbpri558.seq
1460119816 gbpri559.seq
1411410910 gbpri56.seq
1330399589 gbpri560.seq
1414825104 gbpri561.seq
1471697740 gbpri562.seq
1433084067 gbpri563.seq
1478274327 gbpri564.seq
1482687860 gbpri565.seq
1482974764 gbpri566.seq
1480469936 gbpri567.seq
1365267937 gbpri568.seq
1484031460 gbpri569.seq
1340419381 gbpri57.seq
1476809977 gbpri570.seq
1481869552 gbpri571.seq
1470047194 gbpri572.seq
1375002197 gbpri573.seq
1488929328 gbpri574.seq
1489028060 gbpri575.seq
1493835205 gbpri576.seq
1486745077 gbpri577.seq
1437553393 gbpri578.seq
1443179149 gbpri579.seq
1441188568 gbpri58.seq
1460602913 gbpri580.seq
1455986166 gbpri581.seq
1498773877 gbpri582.seq
1499035903 gbpri583.seq
1498350785 gbpri584.seq
1324286020 gbpri585.seq
1342005827 gbpri586.seq
1485309573 gbpri587.seq
1467695018 gbpri588.seq
1475508820 gbpri589.seq
1480666117 gbpri59.seq
1447849220 gbpri590.seq
1433586828 gbpri591.seq
1455303102 gbpri592.seq
1394241071 gbpri593.seq
1428383612 gbpri594.seq
1456849852 gbpri595.seq
1478130441 gbpri596.seq
1430906638 gbpri597.seq
1415832047 gbpri598.seq
1489738461 gbpri599.seq
1372350935 gbpri6.seq
1418186863 gbpri60.seq
1493866735 gbpri600.seq
1458388413 gbpri601.seq
1478199348 gbpri602.seq
1417654857 gbpri603.seq
1497983883 gbpri604.seq
1404955585 gbpri605.seq
1492838254 gbpri606.seq
1497134439 gbpri607.seq
1479735906 gbpri608.seq
1472705450 gbpri609.seq
1439810091 gbpri61.seq
1381720975 gbpri610.seq
1416762592 gbpri611.seq
1495558904 gbpri612.seq
1424515521 gbpri613.seq
1477733469 gbpri614.seq
1464718114 gbpri615.seq
1498933031 gbpri616.seq
1490817778 gbpri617.seq
1491458941 gbpri618.seq
1465681968 gbpri619.seq
1457940176 gbpri62.seq
1496819507 gbpri620.seq
1451050267 gbpri621.seq
1437287082 gbpri622.seq
1440304461 gbpri623.seq
1429844247 gbpri624.seq
1475674737 gbpri625.seq
1449628456 gbpri626.seq
1453162683 gbpri627.seq
1498815168 gbpri628.seq
1492324018 gbpri629.seq
1354428010 gbpri63.seq
1482095198 gbpri630.seq
1467968922 gbpri631.seq
1493794103 gbpri632.seq
1497414154 gbpri633.seq
1493271275 gbpri634.seq
1478807514 gbpri635.seq
1314470939 gbpri636.seq
1449436519 gbpri637.seq
1497023848 gbpri638.seq
1474246118 gbpri639.seq
1498318031 gbpri64.seq
1491146957 gbpri640.seq
1496621910 gbpri641.seq
1472111063 gbpri642.seq
1492255475 gbpri643.seq
1495646498 gbpri644.seq
1476243033 gbpri645.seq
1496643022 gbpri646.seq
1483696357 gbpri647.seq
1382824259 gbpri648.seq
1474515975 gbpri649.seq
1404932319 gbpri65.seq
1451559409 gbpri650.seq
1497404699 gbpri651.seq
1455159667 gbpri652.seq
1470661765 gbpri653.seq
1499809421 gbpri654.seq
1474904775 gbpri655.seq
1496245896 gbpri656.seq
1445251994 gbpri657.seq
1479906220 gbpri658.seq
1499478494 gbpri659.seq
1435930533 gbpri66.seq
1493624391 gbpri660.seq
1499851130 gbpri661.seq
1497674665 gbpri662.seq
1411592327 gbpri663.seq
1489420228 gbpri664.seq
1481062305 gbpri665.seq
1441340535 gbpri666.seq
1497169182 gbpri667.seq
1480589150 gbpri668.seq
1486402030 gbpri669.seq
1499500934 gbpri67.seq
1495900570 gbpri670.seq
1491990715 gbpri671.seq
1496800725 gbpri672.seq
1412443957 gbpri673.seq
1498499804 gbpri674.seq
1429865359 gbpri675.seq
1463482208 gbpri676.seq
1499506329 gbpri677.seq
822028771 gbpri678.seq
1386124160 gbpri68.seq
1294623779 gbpri69.seq
1440746568 gbpri7.seq
1438151750 gbpri70.seq
1430161868 gbpri71.seq
1498693701 gbpri72.seq
1488803493 gbpri73.seq
1367919676 gbpri74.seq
1402453123 gbpri75.seq
1382841152 gbpri76.seq
1486197320 gbpri77.seq
1410633473 gbpri78.seq
1352632885 gbpri79.seq
1473652046 gbpri8.seq
1419080565 gbpri80.seq
1458489606 gbpri81.seq
1291215494 gbpri82.seq
1398782649 gbpri83.seq
1353135812 gbpri84.seq
1403280131 gbpri85.seq
1428137974 gbpri86.seq
1334924951 gbpri87.seq
1417624487 gbpri88.seq
1402680643 gbpri89.seq
1441992628 gbpri9.seq
1477087256 gbpri90.seq
1470398745 gbpri91.seq
1341322037 gbpri92.seq
1474094189 gbpri93.seq
1292086729 gbpri94.seq
1414586173 gbpri95.seq
1434986666 gbpri96.seq
1472844685 gbpri97.seq
1361097032 gbpri98.seq
1397531715 gbpri99.seq
853097 gbrel.txt
1499862285 gbrod1.seq
1477931319 gbrod10.seq
1443709248 gbrod100.seq
1487930170 gbrod101.seq
1352000298 gbrod102.seq
1497255342 gbrod103.seq
1215970140 gbrod104.seq
1323685727 gbrod105.seq
1425029177 gbrod106.seq
1436426304 gbrod107.seq
1498137432 gbrod108.seq
1384334707 gbrod109.seq
1365976721 gbrod11.seq
1497989819 gbrod110.seq
1369805604 gbrod111.seq
1375684152 gbrod112.seq
1183129833 gbrod113.seq
1212798272 gbrod114.seq
1453403074 gbrod115.seq
1470331296 gbrod12.seq
1417227931 gbrod13.seq
1471007422 gbrod14.seq
1438813865 gbrod15.seq
1490541415 gbrod16.seq
1384594948 gbrod17.seq
1420672254 gbrod18.seq
1475952043 gbrod19.seq
1499967437 gbrod2.seq
1397046843 gbrod20.seq
1351547492 gbrod21.seq
1434496523 gbrod22.seq
1387638765 gbrod23.seq
1486251329 gbrod24.seq
1347390436 gbrod25.seq
1452122190 gbrod26.seq
1353193118 gbrod27.seq
1370231234 gbrod28.seq
1370743208 gbrod29.seq
1499850426 gbrod3.seq
1453193685 gbrod30.seq
1484525776 gbrod31.seq
1406105502 gbrod32.seq
1474692538 gbrod33.seq
1404292919 gbrod34.seq
1358612176 gbrod35.seq
1325901204 gbrod36.seq
1445832321 gbrod37.seq
1301809704 gbrod38.seq
1459759409 gbrod39.seq
1499971335 gbrod4.seq
1371820929 gbrod40.seq
1379541974 gbrod41.seq
1447951148 gbrod42.seq
1358076947 gbrod43.seq
1393051649 gbrod44.seq
1377941029 gbrod45.seq
1484184886 gbrod46.seq
1439114050 gbrod47.seq
1409951130 gbrod48.seq
1472027087 gbrod49.seq
1239706517 gbrod5.seq
1372610888 gbrod50.seq
1482622482 gbrod51.seq
1393105943 gbrod52.seq
1451159866 gbrod53.seq
1434520361 gbrod54.seq
1444092726 gbrod55.seq
1361891899 gbrod56.seq
1453486986 gbrod57.seq
1458676727 gbrod58.seq
1379094101 gbrod59.seq
1403075066 gbrod6.seq
1475060334 gbrod60.seq
1359296239 gbrod61.seq
1465899229 gbrod62.seq
1295906456 gbrod63.seq
1477278364 gbrod64.seq
1378018089 gbrod65.seq
1390451722 gbrod66.seq
1462626302 gbrod67.seq
1299128117 gbrod68.seq
1371052535 gbrod69.seq
1462509765 gbrod7.seq
1444445568 gbrod70.seq
1478048412 gbrod71.seq
1480151384 gbrod72.seq
1426832728 gbrod73.seq
1455522110 gbrod74.seq
1332398568 gbrod75.seq
1471786581 gbrod76.seq
1376661169 gbrod77.seq
1454859611 gbrod78.seq
1295571253 gbrod79.seq
1380850319 gbrod8.seq
1399344953 gbrod80.seq
1315896821 gbrod81.seq
1411009597 gbrod82.seq
1453282390 gbrod83.seq
1391252549 gbrod84.seq
1498811032 gbrod85.seq
1444865055 gbrod86.seq
1488474687 gbrod87.seq
1331476829 gbrod88.seq
1465473324 gbrod89.seq
1395344650 gbrod9.seq
1416734769 gbrod90.seq
1486479413 gbrod91.seq
1462152570 gbrod92.seq
1423079792 gbrod93.seq
1368356742 gbrod94.seq
1452029512 gbrod95.seq
1391575059 gbrod96.seq
1477641360 gbrod97.seq
1461787631 gbrod98.seq
1303790964 gbrod99.seq
1499999065 gbsts1.seq
1499998829 gbsts2.seq
1449787244 gbsts3.seq
1434571481 gbsyn1.seq
16084360 gbsyn10.seq
1317756404 gbsyn2.seq
1363478773 gbsyn3.seq
1429349564 gbsyn4.seq
1317756374 gbsyn5.seq
1363478755 gbsyn6.seq
1495750271 gbsyn7.seq
1499986035 gbsyn8.seq
1499999890 gbsyn9.seq
1499999359 gbtsa1.seq
1499998542 gbtsa10.seq
1499998653 gbtsa11.seq
1500000259 gbtsa12.seq
1499995929 gbtsa13.seq
1499999764 gbtsa14.seq
1499998734 gbtsa15.seq
1499998738 gbtsa16.seq
1500000012 gbtsa17.seq
1499999977 gbtsa18.seq
1500000078 gbtsa19.seq
1499998717 gbtsa2.seq
1499998798 gbtsa20.seq
1499998395 gbtsa21.seq
1499998798 gbtsa22.seq
1499997546 gbtsa23.seq
1499999577 gbtsa24.seq
1499999279 gbtsa25.seq
1499992794 gbtsa26.seq
1499994766 gbtsa27.seq
1499995033 gbtsa28.seq
1499999245 gbtsa29.seq
1499998829 gbtsa3.seq
1499997893 gbtsa30.seq
1499999095 gbtsa31.seq
1499994617 gbtsa32.seq
1499998161 gbtsa33.seq
1499997487 gbtsa34.seq
1499999768 gbtsa35.seq
1499999700 gbtsa36.seq
164154553 gbtsa37.seq
1500000215 gbtsa4.seq
1500000258 gbtsa5.seq
1499998665 gbtsa6.seq
1499999377 gbtsa7.seq
1499999658 gbtsa8.seq
1499997214 gbtsa9.seq
7358236 gbuna1.seq
1499959281 gbvrl1.seq
1499549776 gbvrl10.seq
1499950562 gbvrl100.seq
1499992542 gbvrl101.seq
1499959431 gbvrl102.seq
1499957867 gbvrl103.seq
1499994620 gbvrl104.seq
1499939257 gbvrl105.seq
1499976697 gbvrl106.seq
1499994844 gbvrl107.seq
1499952001 gbvrl108.seq
1499981412 gbvrl109.seq
1499981851 gbvrl11.seq
1499944282 gbvrl110.seq
1499980253 gbvrl111.seq
1499971849 gbvrl112.seq
1499968117 gbvrl113.seq
1499987838 gbvrl114.seq
1499973753 gbvrl115.seq
1499978939 gbvrl116.seq
1499990804 gbvrl117.seq
1499969592 gbvrl118.seq
1499975671 gbvrl119.seq
1499992986 gbvrl12.seq
1499992720 gbvrl120.seq
1499936193 gbvrl121.seq
1499971108 gbvrl122.seq
1499955761 gbvrl123.seq
1499980292 gbvrl124.seq
1499981766 gbvrl125.seq
1499985740 gbvrl126.seq
1499942685 gbvrl127.seq
1499997219 gbvrl128.seq
1499989083 gbvrl129.seq
1499985021 gbvrl13.seq
1499947996 gbvrl130.seq
1499948580 gbvrl131.seq
1499989077 gbvrl132.seq
1499981322 gbvrl133.seq
1499943234 gbvrl134.seq
1499980425 gbvrl135.seq
1499959832 gbvrl136.seq
1499946017 gbvrl137.seq
1499942213 gbvrl138.seq
1499999268 gbvrl139.seq
1500000014 gbvrl14.seq
1499990345 gbvrl140.seq
1499979429 gbvrl141.seq
1499986591 gbvrl142.seq
1499979417 gbvrl143.seq
1499986764 gbvrl144.seq
1499934948 gbvrl145.seq
1499969552 gbvrl146.seq
1499942880 gbvrl147.seq
1499973607 gbvrl148.seq
1499948415 gbvrl149.seq
1499965959 gbvrl15.seq
1499974912 gbvrl150.seq
1499940929 gbvrl151.seq
1499937137 gbvrl152.seq
1499975209 gbvrl153.seq
1499942277 gbvrl154.seq
1499959239 gbvrl155.seq
1499949331 gbvrl156.seq
1499950781 gbvrl157.seq
1499984069 gbvrl158.seq
1499973260 gbvrl159.seq
1499964690 gbvrl16.seq
1499999676 gbvrl160.seq
1499955687 gbvrl161.seq
1499959424 gbvrl162.seq
1499960268 gbvrl163.seq
1499993355 gbvrl164.seq
1499933995 gbvrl165.seq
1499961857 gbvrl166.seq
1499984865 gbvrl167.seq
1499702929 gbvrl168.seq
1499934621 gbvrl169.seq
1499982815 gbvrl17.seq
1499979739 gbvrl170.seq
1499999474 gbvrl171.seq
1499990965 gbvrl172.seq
1499994482 gbvrl173.seq
1499989714 gbvrl174.seq
1499937932 gbvrl175.seq
1499947175 gbvrl176.seq
1499947194 gbvrl177.seq
1499956692 gbvrl178.seq
1499948778 gbvrl179.seq
1499965190 gbvrl18.seq
1499995580 gbvrl180.seq
1499960520 gbvrl181.seq
1499994443 gbvrl182.seq
1499865796 gbvrl183.seq
1499942688 gbvrl184.seq
1499952551 gbvrl185.seq
1499936854 gbvrl186.seq
1499979867 gbvrl187.seq
1499992496 gbvrl188.seq
1499975791 gbvrl189.seq
1499950107 gbvrl19.seq
1499962584 gbvrl190.seq
1499973263 gbvrl191.seq
1499962663 gbvrl192.seq
1499992644 gbvrl193.seq
1499961538 gbvrl194.seq
1499976567 gbvrl195.seq
1499975453 gbvrl196.seq
1499980030 gbvrl197.seq
1499971642 gbvrl198.seq
1499990913 gbvrl199.seq
1499999802 gbvrl2.seq
1499949596 gbvrl20.seq
1499976550 gbvrl200.seq
1499986978 gbvrl201.seq
1499982052 gbvrl202.seq
1499987470 gbvrl203.seq
1499971079 gbvrl204.seq
1499991572 gbvrl205.seq
1499970703 gbvrl206.seq
1499983120 gbvrl207.seq
1499971441 gbvrl208.seq
1499989476 gbvrl209.seq
1499937131 gbvrl21.seq
1499963914 gbvrl210.seq
1499966756 gbvrl211.seq
1499998225 gbvrl212.seq
1499982462 gbvrl213.seq
1499990810 gbvrl214.seq
1499986064 gbvrl215.seq
1499971216 gbvrl216.seq
1499999738 gbvrl217.seq
1499974918 gbvrl218.seq
1499994242 gbvrl219.seq
1499987454 gbvrl22.seq
1499972096 gbvrl220.seq
1499964683 gbvrl221.seq
1499964702 gbvrl222.seq
1499995950 gbvrl223.seq
1499990397 gbvrl224.seq
1499992834 gbvrl225.seq
1499965326 gbvrl226.seq
1499979810 gbvrl227.seq
1499979811 gbvrl228.seq
1499994887 gbvrl229.seq
1499955779 gbvrl23.seq
1499982508 gbvrl230.seq
1499994881 gbvrl231.seq
1499971089 gbvrl232.seq
1499970761 gbvrl233.seq
1499965156 gbvrl234.seq
1499991441 gbvrl235.seq
1499976735 gbvrl236.seq
1499963197 gbvrl237.seq
1499979818 gbvrl238.seq
1499987095 gbvrl239.seq
1499949356 gbvrl24.seq
1499987139 gbvrl240.seq
1499984586 gbvrl241.seq
1499974787 gbvrl242.seq
1499990862 gbvrl243.seq
1499975574 gbvrl244.seq
1499967076 gbvrl245.seq
1499969177 gbvrl246.seq
1499979659 gbvrl247.seq
1499996122 gbvrl248.seq
1499994259 gbvrl249.seq
1499942769 gbvrl25.seq
1499963281 gbvrl250.seq
1499976943 gbvrl251.seq
1499991490 gbvrl252.seq
1499987190 gbvrl253.seq
1499994083 gbvrl254.seq
1499993946 gbvrl255.seq
1499973611 gbvrl256.seq
1499992251 gbvrl257.seq
1499968355 gbvrl258.seq
1499972989 gbvrl259.seq
1499988015 gbvrl26.seq
1499993805 gbvrl260.seq
1499973321 gbvrl261.seq
1499973506 gbvrl262.seq
1499996027 gbvrl263.seq
1499994005 gbvrl264.seq
1499975923 gbvrl265.seq
1499966620 gbvrl266.seq
1499974552 gbvrl267.seq
1499965250 gbvrl268.seq
1499976537 gbvrl269.seq
1499970222 gbvrl27.seq
1499966661 gbvrl270.seq
1499984837 gbvrl271.seq
1499966726 gbvrl272.seq
1499970667 gbvrl273.seq
1499970742 gbvrl274.seq
1499987705 gbvrl275.seq
1499984237 gbvrl276.seq
1499991885 gbvrl277.seq
1499976065 gbvrl278.seq
1499978250 gbvrl279.seq
1499990290 gbvrl28.seq
1499998818 gbvrl280.seq
1499979230 gbvrl281.seq
1499986883 gbvrl282.seq
1499993457 gbvrl283.seq
1499991162 gbvrl284.seq
1499986107 gbvrl285.seq
1499971584 gbvrl286.seq
1499999674 gbvrl287.seq
1499973779 gbvrl288.seq
1499970409 gbvrl289.seq
1499956889 gbvrl29.seq
1499971141 gbvrl290.seq
1499968687 gbvrl291.seq
1499985724 gbvrl292.seq
1499963563 gbvrl293.seq
1499965248 gbvrl294.seq
1499968844 gbvrl295.seq
1499966009 gbvrl296.seq
1499995329 gbvrl297.seq
1499984738 gbvrl298.seq
1499983519 gbvrl299.seq
1499999252 gbvrl3.seq
1499974920 gbvrl30.seq
1499961047 gbvrl300.seq
1499997768 gbvrl301.seq
1499987389 gbvrl302.seq
1499974695 gbvrl303.seq
1499986798 gbvrl304.seq
1499975309 gbvrl305.seq
1499981095 gbvrl306.seq
1499996651 gbvrl307.seq
1499962694 gbvrl308.seq
1499990639 gbvrl309.seq
1499978732 gbvrl31.seq
1499953632 gbvrl310.seq
1499996290 gbvrl311.seq
1499996570 gbvrl312.seq
1499996109 gbvrl313.seq
1499960097 gbvrl314.seq
1499966633 gbvrl315.seq
1499984037 gbvrl316.seq
1499999926 gbvrl317.seq
1500000004 gbvrl318.seq
1499945992 gbvrl319.seq
1499937009 gbvrl32.seq
1499955284 gbvrl320.seq
1499970934 gbvrl321.seq
1499982965 gbvrl322.seq
1499990540 gbvrl323.seq
1499980697 gbvrl324.seq
1499978649 gbvrl325.seq
1499995805 gbvrl326.seq
1499979610 gbvrl327.seq
1499936897 gbvrl328.seq
1499987382 gbvrl329.seq
1499941159 gbvrl33.seq
1499636067 gbvrl330.seq
1499977385 gbvrl331.seq
1499976854 gbvrl332.seq
1499962453 gbvrl333.seq
1499952649 gbvrl334.seq
1499974719 gbvrl335.seq
1499998812 gbvrl336.seq
313999547 gbvrl337.seq
1499939121 gbvrl34.seq
1499955872 gbvrl35.seq
1499969570 gbvrl36.seq
1499951994 gbvrl37.seq
1499961886 gbvrl38.seq
1499970874 gbvrl39.seq
1499998894 gbvrl4.seq
1499966173 gbvrl40.seq
1499985251 gbvrl41.seq
1499980009 gbvrl42.seq
1499962646 gbvrl43.seq
1499937548 gbvrl44.seq
1499954888 gbvrl45.seq
1499998481 gbvrl46.seq
1499939699 gbvrl47.seq
1499984031 gbvrl48.seq
1499951515 gbvrl49.seq
1499999279 gbvrl5.seq
1499933333 gbvrl50.seq
1499987081 gbvrl51.seq
1499990221 gbvrl52.seq
1499983617 gbvrl53.seq
1499947940 gbvrl54.seq
1499980861 gbvrl55.seq
1499972718 gbvrl56.seq
1499977425 gbvrl57.seq
1499981000 gbvrl58.seq
1499961684 gbvrl59.seq
1499752296 gbvrl6.seq
1499972247 gbvrl60.seq
1499956734 gbvrl61.seq
1499975356 gbvrl62.seq
1499981128 gbvrl63.seq
1499952864 gbvrl64.seq
1499963798 gbvrl65.seq
1499936136 gbvrl66.seq
1499989499 gbvrl67.seq
1499955081 gbvrl68.seq
1499939920 gbvrl69.seq
1499998727 gbvrl7.seq
1499958539 gbvrl70.seq
1499972986 gbvrl71.seq
1499962490 gbvrl72.seq
1499961627 gbvrl73.seq
1499980903 gbvrl74.seq
1499941722 gbvrl75.seq
1499981748 gbvrl76.seq
1499944101 gbvrl77.seq
1499949731 gbvrl78.seq
1499937128 gbvrl79.seq
1499998196 gbvrl8.seq
1499966510 gbvrl80.seq
1499958349 gbvrl81.seq
1499976206 gbvrl82.seq
1499989408 gbvrl83.seq
1499945815 gbvrl84.seq
1499952177 gbvrl85.seq
1499952307 gbvrl86.seq
1499972980 gbvrl87.seq
1499996285 gbvrl88.seq
1499938903 gbvrl89.seq
1499985707 gbvrl9.seq
1499974655 gbvrl90.seq
1499971948 gbvrl91.seq
1499949655 gbvrl92.seq
1499993983 gbvrl93.seq
1499947187 gbvrl94.seq
1499949623 gbvrl95.seq
1499944556 gbvrl96.seq
1499976691 gbvrl97.seq
1499935231 gbvrl98.seq
1499944170 gbvrl99.seq
1468710280 gbvrt1.seq
1282109096 gbvrt10.seq
1484013960 gbvrt100.seq
1482078258 gbvrt101.seq
1197613438 gbvrt102.seq
1262095184 gbvrt103.seq
1090722360 gbvrt104.seq
1424049174 gbvrt105.seq
1496909957 gbvrt106.seq
1493025075 gbvrt107.seq
1320575219 gbvrt108.seq
1436638097 gbvrt109.seq
1394599173 gbvrt11.seq
1458922406 gbvrt110.seq
1491575244 gbvrt111.seq
1281300277 gbvrt112.seq
1411652468 gbvrt113.seq
1421545558 gbvrt114.seq
1476891269 gbvrt115.seq
1386060829 gbvrt116.seq
1433021643 gbvrt117.seq
1497612563 gbvrt118.seq
1486330678 gbvrt119.seq
1454801948 gbvrt12.seq
1462604299 gbvrt120.seq
1476857854 gbvrt121.seq
1488438777 gbvrt122.seq
1462478284 gbvrt123.seq
1498078979 gbvrt124.seq
1484861739 gbvrt125.seq
1477143564 gbvrt126.seq
1483219404 gbvrt127.seq
1463588150 gbvrt128.seq
1491354277 gbvrt129.seq
1478611349 gbvrt13.seq
1497114650 gbvrt130.seq
1478208496 gbvrt131.seq
1462060438 gbvrt132.seq
1385749837 gbvrt133.seq
1470368193 gbvrt134.seq
1486674105 gbvrt135.seq
1419336196 gbvrt136.seq
1491622767 gbvrt137.seq
1480809421 gbvrt138.seq
1474597440 gbvrt139.seq
1453727441 gbvrt14.seq
1498459033 gbvrt140.seq
1436819628 gbvrt141.seq
1480754470 gbvrt142.seq
1473702580 gbvrt143.seq
1483456760 gbvrt144.seq
1460587689 gbvrt145.seq
1491277907 gbvrt146.seq
1433698722 gbvrt147.seq
1392969255 gbvrt148.seq
1458594989 gbvrt149.seq
1496026278 gbvrt15.seq
1497316015 gbvrt150.seq
1416739574 gbvrt151.seq
1485249531 gbvrt152.seq
1468995634 gbvrt153.seq
1495839785 gbvrt154.seq
1361029027 gbvrt155.seq
1454564111 gbvrt156.seq
1463902579 gbvrt157.seq
1483704254 gbvrt158.seq
1320939161 gbvrt159.seq
1461881412 gbvrt16.seq
1450812981 gbvrt160.seq
1478017801 gbvrt161.seq
1392442116 gbvrt162.seq
1496121979 gbvrt163.seq
1429716567 gbvrt164.seq
1495014546 gbvrt165.seq
1444533644 gbvrt166.seq
1472525288 gbvrt167.seq
1371889473 gbvrt168.seq
1458168336 gbvrt169.seq
1464017796 gbvrt17.seq
1480325666 gbvrt170.seq
1333470830 gbvrt171.seq
1339390452 gbvrt172.seq
1446769447 gbvrt173.seq
1432904863 gbvrt174.seq
1469966670 gbvrt175.seq
1484040009 gbvrt176.seq
1496855706 gbvrt177.seq
1433040470 gbvrt178.seq
1375266246 gbvrt179.seq
1499931572 gbvrt18.seq
1483347947 gbvrt180.seq
1363503090 gbvrt181.seq
1442347330 gbvrt182.seq
1494535064 gbvrt183.seq
1440727248 gbvrt184.seq
1472724385 gbvrt185.seq
1399605061 gbvrt186.seq
1291348384 gbvrt187.seq
1492986566 gbvrt188.seq
1497829903 gbvrt189.seq
1499998053 gbvrt19.seq
1436699186 gbvrt190.seq
1173719027 gbvrt191.seq
1470502273 gbvrt192.seq
1336897357 gbvrt193.seq
1451022601 gbvrt194.seq
1496444625 gbvrt195.seq
1452606394 gbvrt196.seq
1498405608 gbvrt197.seq
1458261551 gbvrt198.seq
1422476619 gbvrt199.seq
1488073608 gbvrt2.seq
1499997976 gbvrt20.seq
1465708115 gbvrt200.seq
1479745451 gbvrt201.seq
1495244154 gbvrt202.seq
1468455350 gbvrt203.seq
1484551004 gbvrt204.seq
1341285700 gbvrt205.seq
1391197912 gbvrt206.seq
1409281707 gbvrt207.seq
1244065533 gbvrt208.seq
1487136121 gbvrt209.seq
1499998994 gbvrt21.seq
1489780401 gbvrt210.seq
1493866969 gbvrt211.seq
1487035640 gbvrt212.seq
1478584592 gbvrt213.seq
1485918275 gbvrt214.seq
1444589689 gbvrt215.seq
1499541605 gbvrt216.seq
1448188156 gbvrt217.seq
889072804 gbvrt218.seq
1750969594 gbvrt219.seq
1499998804 gbvrt22.seq
1582584122 gbvrt220.seq
1439178988 gbvrt221.seq
1385914538 gbvrt222.seq
1260623871 gbvrt223.seq
1241027078 gbvrt224.seq
1394205943 gbvrt225.seq
647635060 gbvrt226.seq
1800655812 gbvrt227.seq
1625880297 gbvrt228.seq
1452341451 gbvrt229.seq
1499998389 gbvrt23.seq
1413268707 gbvrt230.seq
1301679404 gbvrt231.seq
1265017882 gbvrt232.seq
1398329117 gbvrt233.seq
646313711 gbvrt234.seq
2486764648 gbvrt235.seq
2399841711 gbvrt236.seq
2168065652 gbvrt237.seq
1730481357 gbvrt238.seq
1674077467 gbvrt239.seq
1498644248 gbvrt24.seq
1643880041 gbvrt240.seq
1613167793 gbvrt241.seq
1585967368 gbvrt242.seq
1573317635 gbvrt243.seq
1525189779 gbvrt244.seq
1522308102 gbvrt245.seq
1503557506 gbvrt246.seq
1502833827 gbvrt247.seq
1439581620 gbvrt248.seq
1297818631 gbvrt249.seq
1495178167 gbvrt25.seq
1258324368 gbvrt250.seq
1369247334 gbvrt251.seq
1368865938 gbvrt252.seq
1472115430 gbvrt253.seq
1449680126 gbvrt254.seq
1309689855 gbvrt255.seq
1469430849 gbvrt256.seq
1466100957 gbvrt257.seq
1392101492 gbvrt258.seq
1390671725 gbvrt259.seq
1499914272 gbvrt26.seq
1408841519 gbvrt260.seq
1498224495 gbvrt261.seq
1475026708 gbvrt262.seq
1464576040 gbvrt263.seq
1459906041 gbvrt264.seq
1465282649 gbvrt265.seq
286802878 gbvrt266.seq
2737865440 gbvrt267.seq
582597811 gbvrt268.seq
2729824435 gbvrt269.seq
1475442725 gbvrt27.seq
666748676 gbvrt270.seq
2720117404 gbvrt271.seq
646964638 gbvrt272.seq
2731547963 gbvrt273.seq
195179179 gbvrt274.seq
2734657827 gbvrt275.seq
21623841 gbvrt276.seq
2728895745 gbvrt277.seq
2505979018 gbvrt278.seq
2204702755 gbvrt279.seq
1478369196 gbvrt28.seq
1642333222 gbvrt280.seq
1549476405 gbvrt281.seq
1535228181 gbvrt282.seq
1466613005 gbvrt283.seq
1478204774 gbvrt284.seq
1470950309 gbvrt285.seq
186687778 gbvrt286.seq
2736013151 gbvrt287.seq
466831313 gbvrt288.seq
2724707547 gbvrt289.seq
1458069718 gbvrt29.seq
428842069 gbvrt290.seq
2726904396 gbvrt291.seq
418344636 gbvrt292.seq
2737394570 gbvrt293.seq
32900508 gbvrt294.seq
2595542382 gbvrt295.seq
2455087006 gbvrt296.seq
2265220339 gbvrt297.seq
2012454031 gbvrt298.seq
1582208555 gbvrt299.seq
1487660705 gbvrt3.seq
1491451906 gbvrt30.seq
1469382459 gbvrt300.seq
1410611776 gbvrt301.seq
1422190236 gbvrt302.seq
1462005873 gbvrt303.seq
1484741743 gbvrt304.seq
1485090814 gbvrt305.seq
1490726491 gbvrt306.seq
1409295542 gbvrt307.seq
1415524312 gbvrt308.seq
1419887839 gbvrt309.seq
1344236377 gbvrt31.seq
1489003648 gbvrt310.seq
1450997370 gbvrt311.seq
1416322818 gbvrt312.seq
1087669617 gbvrt313.seq
1499731259 gbvrt314.seq
1497257661 gbvrt315.seq
1481805507 gbvrt316.seq
1479706062 gbvrt317.seq
1492516750 gbvrt318.seq
1483616920 gbvrt319.seq
1275178748 gbvrt32.seq
1110796224 gbvrt320.seq
1477203763 gbvrt321.seq
1491448962 gbvrt322.seq
1442533467 gbvrt323.seq
1440707677 gbvrt324.seq
1450925114 gbvrt325.seq
1465167720 gbvrt326.seq
1469887419 gbvrt327.seq
1493691922 gbvrt328.seq
1417155344 gbvrt329.seq
1464690866 gbvrt33.seq
1328714210 gbvrt330.seq
1135819087 gbvrt331.seq
952384782 gbvrt332.seq
872251544 gbvrt333.seq
858760811 gbvrt334.seq
1138273420 gbvrt335.seq
1420474204 gbvrt336.seq
1408136024 gbvrt337.seq
1486210615 gbvrt338.seq
1489796585 gbvrt339.seq
1472900752 gbvrt34.seq
1401076841 gbvrt340.seq
1473258470 gbvrt341.seq
1404838293 gbvrt342.seq
1473583203 gbvrt343.seq
1404913548 gbvrt344.seq
1477020194 gbvrt345.seq
1397059913 gbvrt346.seq
1475549804 gbvrt347.seq
1410126884 gbvrt348.seq
1472429474 gbvrt349.seq
1494357791 gbvrt35.seq
1388472387 gbvrt350.seq
1444039874 gbvrt351.seq
1448790743 gbvrt352.seq
1444806391 gbvrt353.seq
1354493522 gbvrt354.seq
1475110803 gbvrt355.seq
1407513438 gbvrt356.seq
1470754045 gbvrt357.seq
1410492150 gbvrt358.seq
1451274358 gbvrt359.seq
711507248 gbvrt36.seq
1491827559 gbvrt360.seq
1469217906 gbvrt361.seq
1431508692 gbvrt362.seq
1465875271 gbvrt363.seq
1492092147 gbvrt364.seq
1489236528 gbvrt365.seq
1431828008 gbvrt366.seq
1408042696 gbvrt367.seq
1479094683 gbvrt368.seq
384848696 gbvrt369.seq
1063697372 gbvrt37.seq
1045817455 gbvrt38.seq
1371630420 gbvrt39.seq
1499992349 gbvrt4.seq
1358087426 gbvrt40.seq
1409890116 gbvrt41.seq
1495658777 gbvrt42.seq
1468214202 gbvrt43.seq
1497507497 gbvrt44.seq
1392041424 gbvrt45.seq
838606763 gbvrt46.seq
1154852032 gbvrt47.seq
1294541035 gbvrt48.seq
1495334811 gbvrt49.seq
1460035593 gbvrt5.seq
1471849771 gbvrt50.seq
1495075479 gbvrt51.seq
1443062910 gbvrt52.seq
1495785632 gbvrt53.seq
1476010173 gbvrt54.seq
1465137855 gbvrt55.seq
1282827292 gbvrt56.seq
1432076811 gbvrt57.seq
1499422517 gbvrt58.seq
1473624134 gbvrt59.seq
1488052262 gbvrt6.seq
1494431972 gbvrt60.seq
1230349555 gbvrt61.seq
1413618697 gbvrt62.seq
1330262106 gbvrt63.seq
1463202068 gbvrt64.seq
1491604647 gbvrt65.seq
1469825980 gbvrt66.seq
1495977022 gbvrt67.seq
1412203616 gbvrt68.seq
1485152845 gbvrt69.seq
1498753855 gbvrt7.seq
1499863036 gbvrt70.seq
1421892042 gbvrt71.seq
1440473233 gbvrt72.seq
1451333745 gbvrt73.seq
1480202965 gbvrt74.seq
1472327219 gbvrt75.seq
1468479423 gbvrt76.seq
1483155919 gbvrt77.seq
566961473 gbvrt78.seq
1068402515 gbvrt79.seq
1480906084 gbvrt8.seq
1067356332 gbvrt80.seq
896844818 gbvrt81.seq
805318346 gbvrt82.seq
1275607077 gbvrt83.seq
1208361643 gbvrt84.seq
874873714 gbvrt85.seq
1313422786 gbvrt86.seq
1438940816 gbvrt87.seq
1490321479 gbvrt88.seq
1467796566 gbvrt89.seq
1444675895 gbvrt9.seq
1499998413 gbvrt90.seq
1499999872 gbvrt91.seq
1423669544 gbvrt92.seq
1499771743 gbvrt93.seq
1468775314 gbvrt94.seq
1481671623 gbvrt95.seq
1485228638 gbvrt96.seq
1459231675 gbvrt97.seq
1495826999 gbvrt98.seq
1495396214 gbvrt99.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 179374 601308029
BCT10 328 681959361
BCT100 317 700520221
BCT101 235 655040719
BCT102 356 668862415
BCT103 390 677900414
BCT104 258 684157268
BCT105 428 707646878
BCT106 396 654265957
BCT107 451 745157846
BCT108 306 676766279
BCT109 1270 689172269
BCT11 398 744047040
BCT110 336 675596173
BCT111 420 668870015
BCT112 466 669797479
BCT113 438 659293372
BCT114 354 707339225
BCT115 378 688257074
BCT116 371 677207259
BCT117 292 677138095
BCT118 243 658232077
BCT119 454 719278604
BCT12 431 753399892
BCT120 462 700765936
BCT121 205 673631081
BCT122 311 664357542
BCT123 427 699811935
BCT124 426 726770426
BCT125 611 706064610
BCT126 358 701553328
BCT127 296 675165020
BCT128 367 675063078
BCT129 375 783574927
BCT13 416 685485982
BCT130 306 735812665
BCT131 365 668980440
BCT132 376 675256283
BCT133 408 675462061
BCT134 457 682105140
BCT135 400 676426087
BCT136 334 671757249
BCT137 332 782725022
BCT138 359 661126029
BCT139 292 704776530
BCT14 583 672320818
BCT140 340 669953606
BCT141 382 664496592
BCT142 438 677886534
BCT143 462 656888521
BCT144 342 762173784
BCT145 342 675340827
BCT146 261 669256459
BCT147 396 666807571
BCT148 342 668753810
BCT149 735 642803332
BCT15 541 673440342
BCT150 501 646285823
BCT151 512 651966035
BCT152 434 639675092
BCT153 438 638792660
BCT154 437 634469459
BCT155 446 707110335
BCT156 432 676681695
BCT157 376 686896957
BCT158 387 699736970
BCT159 309 707751505
BCT16 480 666804190
BCT160 409 713168205
BCT161 366 671560667
BCT162 462 678785702
BCT163 331 693679744
BCT164 406 658258159
BCT165 436 676068612
BCT166 400 824204917
BCT167 523 705297286
BCT168 323 679231779
BCT169 306 678896998
BCT17 306 675367893
BCT170 400 651609782
BCT171 382 668736928
BCT172 562 687126008
BCT173 341 655022411
BCT174 495 637711669
BCT175 426 686791611
BCT176 454 657726886
BCT177 331 713812893
BCT178 466 710825720
BCT179 401 728621785
BCT18 142 671234032
BCT180 406 676072708
BCT181 321 660330826
BCT182 346 674706354
BCT183 334 674443175
BCT184 426 670295104
BCT185 414 707924245
BCT186 494 674464432
BCT187 376 665263146
BCT188 284 646142012
BCT189 324 654891205
BCT19 260 675722890
BCT190 337 672903076
BCT191 427 737438534
BCT192 263 671544013
BCT193 309 658725619
BCT194 365 656576304
BCT195 341 646182493
BCT196 357 685184331
BCT197 370 677390837
BCT198 363 929872378
BCT199 373 769949984
BCT2 26411 629594060
BCT20 260 684236744
BCT200 394 662526889
BCT201 436 662825357
BCT202 396 721458866
BCT203 373 723487131
BCT204 440 679642609
BCT205 580 691177648
BCT206 375 661308758
BCT207 363 643048210
BCT208 483 682746084
BCT209 416 675458129
BCT21 70228 634728694
BCT210 432 684083544
BCT211 373 671748726
BCT212 378 662700470
BCT213 328 669261282
BCT214 296 653973339
BCT215 302 684119309
BCT216 590 656234161
BCT217 339 689691536
BCT218 373 664719643
BCT219 301 654353187
BCT22 328 685853102
BCT220 419 633418524
BCT221 349 654028649
BCT222 330 723785497
BCT223 348 663026439
BCT224 354 675444383
BCT225 373 686202364
BCT226 298 664008665
BCT227 364 647474185
BCT228 455 671809452
BCT229 318 658150170
BCT23 395 674384821
BCT230 301 641304358
BCT231 328 641910115
BCT232 336 635631818
BCT233 388 657189446
BCT234 423 672410310
BCT235 546 664130372
BCT236 356 634028998
BCT237 319 695360854
BCT238 365 645728035
BCT239 309 673455004
BCT24 562 678961658
BCT240 362 635738211
BCT241 391 633831324
BCT242 367 623878960
BCT243 332 617797660
BCT244 315 638272907
BCT245 498 756939572
BCT246 415 624192752
BCT247 452 675410492
BCT248 383 643544245
BCT249 279 659293280
BCT25 342 669250333
BCT250 382 656922045
BCT251 293 655986882
BCT252 433 660067687
BCT253 336 640309709
BCT254 330 638067301
BCT255 385 633289613
BCT256 322 649573220
BCT257 316 667036730
BCT258 425 749920951
BCT259 123 647075266
BCT26 419 669548766
BCT260 107 642862116
BCT261 119 645421192
BCT262 140 647045916
BCT263 128 646916150
BCT264 163 647729945
BCT265 161 652234999
BCT266 141 646585323
BCT267 123 645560933
BCT268 143 650723476
BCT269 133 648226487
BCT27 363 676878429
BCT270 138 649792388
BCT271 262 661013477
BCT272 386 698772349
BCT273 321 659068391
BCT274 425 650952543
BCT275 1417 626225231
BCT276 561 662601682
BCT277 293 672922668
BCT278 501 667520370
BCT279 255 661836801
BCT28 360 686762894
BCT280 241 636579539
BCT281 403 659929789
BCT282 448 645216928
BCT283 401 639718454
BCT284 269 624178978
BCT285 427 662376078
BCT286 330 659566527
BCT287 288 684221787
BCT288 448 682294886
BCT289 420 675061247
BCT29 432 689683537
BCT290 399 633586086
BCT291 304 686331491
BCT292 336 644418328
BCT293 388 664774781
BCT294 423 718594994
BCT295 615 635222668
BCT296 453 659004725
BCT297 520 641947149
BCT298 320 630628856
BCT299 472 621123423
BCT3 381 729800735
BCT30 355 713240999
BCT300 301 642269874
BCT301 182 626827422
BCT302 308 639410149
BCT303 377 626376029
BCT304 353 645128423
BCT305 412 621846973
BCT306 271 657598658
BCT307 404 615703873
BCT308 397 634119611
BCT309 415 660179527
BCT31 795 688127657
BCT310 353 685699605
BCT311 478 913842424
BCT312 592 689427888
BCT313 405 685960658
BCT314 325 650893056
BCT315 329 646721344
BCT316 306 625763957
BCT317 364 640390814
BCT318 417 656607436
BCT319 394 641865286
BCT32 345 684439266
BCT320 320 685268905
BCT321 305 660569108
BCT322 378 654683086
BCT323 270 642410504
BCT324 419 664530196
BCT325 411 770767302
BCT326 325 644738459
BCT327 363 628852735
BCT328 354 640629954
BCT329 365 652863521
BCT33 269 668239748
BCT330 394 651629455
BCT331 213 642941532
BCT332 219 619795834
BCT333 431 635000624
BCT334 395 637424400
BCT335 303 643498224
BCT336 495 617021173
BCT337 392 672842192
BCT338 352 629958830
BCT339 429 689350964
BCT34 138 634874625
BCT340 295 662221439
BCT341 480 606943293
BCT342 476 633619922
BCT343 355 609442308
BCT344 356 638440086
BCT345 173 629994009
BCT346 175 660491663
BCT347 373 693556350
BCT348 423 638973423
BCT349 232 627937384
BCT35 236 662324366
BCT350 302 629840508
BCT351 338 617501604
BCT352 344 602862698
BCT353 399 599881610
BCT354 364 600919106
BCT355 379 596967502
BCT356 335 618354420
BCT357 327 622831877
BCT358 193 639300168
BCT359 394 636266513
BCT36 329 699800407
BCT360 337 670400088
BCT361 349 633480023
BCT362 343 604055078
BCT363 348 641896216
BCT364 305 651472215
BCT365 482 654183088
BCT366 406 634872551
BCT367 395 627266591
BCT368 354 628053584
BCT369 550 606937199
BCT37 266 690971403
BCT370 558 606257494
BCT371 560 604759611
BCT372 452 621251264
BCT373 350 625449330
BCT374 317 653995235
BCT375 295 622852294
BCT376 375 642278714
BCT377 329 614824265
BCT378 371 623359088
BCT379 451 736391212
BCT38 260 689820048
BCT380 400 656205177
BCT381 552 786619725
BCT382 429 704864835
BCT383 248 609350509
BCT384 284 660538409
BCT385 375 614673691
BCT386 319 688086008
BCT387 353 652957914
BCT388 291 682475770
BCT389 275 613460331
BCT39 290 702995313
BCT390 838 1033720485
BCT391 296 650537480
BCT392 579 620561170
BCT393 375 624975728
BCT394 354 694891041
BCT395 380 648797639
BCT396 258149 517686967
BCT397 17578 618460455
BCT398 119590 632766293
BCT399 166247 571174145
BCT4 489 739166734
BCT40 373 674766736
BCT400 434863 462483138
BCT401 336762 546364319
BCT402 22430 772009312
BCT403 3401 720348256
BCT404 189 663402592
BCT405 2045 740619215
BCT406 2185 852169839
BCT407 4566 817648771
BCT408 1229 1180631499
BCT409 2412 740342061
BCT41 295 668590226
BCT410 4706 711531579
BCT411 1169 749622481
BCT412 5485 826387542
BCT413 109465 744613691
BCT414 331911 585067023
BCT415 285535 690903806
BCT416 146071 765238017
BCT417 561 619432628
BCT418 531 619309267
BCT419 625 617126535
BCT42 464 670477115
BCT420 727 639211061
BCT421 1359 813643663
BCT422 1311 707821424
BCT423 774 1137300146
BCT424 822 1180713758
BCT425 747 1180488279
BCT426 877 1173812324
BCT427 782 1111804538
BCT428 161082 509137999
BCT43 231 672080592
BCT44 305 670403588
BCT45 216 667436201
BCT46 268 671931342
BCT47 366 671127408
BCT48 320 678490558
BCT49 299 680604025
BCT5 535 720960951
BCT50 345 662952861
BCT51 293 656554654
BCT52 356 663933532
BCT53 392 659510243
BCT54 344 661210098
BCT55 373 671201593
BCT56 353 678394155
BCT57 284 673822903
BCT58 411 667963409
BCT59 267 669863705
BCT6 421 681407729
BCT60 355 679557788
BCT61 335 689131003
BCT62 298 670921342
BCT63 355 665905260
BCT64 413 681631768
BCT65 322 653356364
BCT66 335 680117364
BCT67 345 708774658
BCT68 333 667974051
BCT69 366 673970797
BCT7 483 668491491
BCT70 396 706022292
BCT71 342 661698635
BCT72 307 698900362
BCT73 304 676123189
BCT74 316 688432425
BCT75 313 679554305
BCT76 313 805226534
BCT77 579 728925990
BCT78 343 658468212
BCT79 278 696051941
BCT8 358 686419098
BCT80 275 667442591
BCT81 342 727409863
BCT82 314 674114640
BCT83 296 705151311
BCT84 299 771184786
BCT85 355 703230842
BCT86 342 805692767
BCT87 255 676204790
BCT88 319 696252779
BCT89 309 661401227
BCT9 304 694758490
BCT90 316 686406994
BCT91 301 672572368
BCT92 298 695125560
BCT93 305 677729253
BCT94 463 658783316
BCT95 369 706882959
BCT96 383 709088724
BCT97 314 665675861
BCT98 448 676085305
BCT99 297 669687927
ENV1 405019 504257701
ENV10 532616 403419566
ENV11 537222 417738029
ENV12 582833 358815966
ENV13 423271 359640151
ENV14 553243 370984774
ENV15 519820 380512293
ENV16 529267 342817076
ENV17 640376 260059403
ENV18 661021 292511786
ENV19 570564 308084714
ENV2 396 737977271
ENV20 522556 461639183
ENV21 617978 324484394
ENV22 281811 574954072
ENV23 191363 609313995
ENV24 175481 953387412
ENV25 484 1176505260
ENV26 565 1179818561
ENV27 1304 1182674014
ENV28 3184 1145651425
ENV29 1044 1180498096
ENV3 219 651498736
ENV30 75395 456335269
ENV4 367 686650212
ENV5 28801 697179061
ENV6 586637 411957861
ENV7 585430 400347278
ENV8 580720 390453801
ENV9 710254 308753781
EST1 465977 174308554
EST10 482030 205956479
EST100 517214 306896898
EST101 571936 237568561
EST102 559369 267562228
EST103 439015 278632073
EST104 452343 282557755
EST105 457820 286452554
EST106 453497 316319391
EST107 467400 316458209
EST108 406793 276442033
EST109 451792 300826937
EST11 471720 197517167
EST110 443961 266858496
EST111 430239 269290931
EST112 464193 261098735
EST113 350908 223196605
EST114 476175 240316635
EST115 485240 274519462
EST116 395849 254678015
EST117 482585 288224227
EST118 382570 254300551
EST119 370415 210404179
EST12 322566 106741653
EST120 445300 110465088
EST121 655040 335408662
EST122 445160 268677598
EST123 524947 277233004
EST124 589938 303309192
EST125 512569 306853675
EST126 515329 334529213
EST127 491985 335014363
EST128 531437 311271183
EST129 557151 334015029
EST13 301750 92370944
EST130 598266 376970000
EST131 585002 425085795
EST132 517454 259558513
EST133 450257 56837725
EST134 437365 142244520
EST135 494019 303510514
EST136 424984 297120562
EST137 466074 305633494
EST138 478152 185063656
EST139 440865 280419468
EST14 347486 167094833
EST140 484096 310349129
EST141 424724 267555283
EST142 475629 271472809
EST143 416641 264247741
EST144 306964 202315511
EST145 388272 241731006
EST146 471065 264419046
EST147 468685 271107175
EST148 478024 305626592
EST149 548773 328902978
EST15 493153 244488982
EST150 403119 268590317
EST151 557524 237531251
EST152 547684 277307732
EST153 557198 344420446
EST154 545748 301526568
EST155 603963 357004449
EST156 550214 333662173
EST157 455937 290505754
EST158 469758 250925766
EST159 495386 287500394
EST16 474029 251369765
EST160 523432 331946694
EST161 527176 335548270
EST162 702824 311099913
EST163 525697 268568096
EST164 163359 63208934
EST17 457758 255501513
EST18 450195 229865953
EST19 474459 243731957
EST2 491819 192418565
EST20 456049 290338376
EST21 490016 267390791
EST22 438185 247246187
EST23 475096 272527393
EST24 580937 324459130
EST25 475148 257847613
EST26 435811 254797037
EST27 459613 251077789
EST28 612293 324498393
EST29 477759 253013323
EST3 502232 208186542
EST30 458347 254214862
EST31 441025 288327747
EST32 407517 291485791
EST33 506143 301713702
EST34 646414 372149533
EST35 492891 313663012
EST36 399222 228757285
EST37 251820 94149663
EST38 250654 102520063
EST39 326669 158073598
EST4 481134 204966535
EST40 458605 260623186
EST41 481767 267321404
EST42 445853 239434081
EST43 477943 281969549
EST44 514637 258510067
EST45 432089 256079202
EST46 555574 284603927
EST47 428560 244673471
EST48 427352 248375085
EST49 356406 171260642
EST5 553107 304476910
EST50 379985 160904821
EST51 497756 268636218
EST52 567857 321121597
EST53 424674 286369047
EST54 443976 244346671
EST55 480022 282634819
EST56 435394 237995177
EST57 475822 267278447
EST58 456637 277470775
EST59 423536 247573762
EST6 554207 330662479
EST60 493754 328275760
EST61 453327 279888595
EST62 446616 228553011
EST63 442043 273130945
EST64 430902 276107373
EST65 387152 256254326
EST66 499177 272651679
EST67 492316 275439844
EST68 504926 275539045
EST69 546346 305146330
EST7 540131 306871824
EST70 553845 334754959
EST71 537278 343616482
EST72 571878 312785275
EST73 457904 272315945
EST74 455604 315158673
EST75 436970 293024738
EST76 478518 283482309
EST77 381887 266634757
EST78 394200 275456664
EST79 386864 268025112
EST8 444497 136287887
EST80 405954 312575475
EST81 481913 303439420
EST82 444172 320753532
EST83 527366 302519541
EST84 595623 185416154
EST85 484789 324351119
EST86 500823 319909027
EST87 514473 307401697
EST88 665616 324915203
EST89 573604 245949949
EST9 610732 285550417
EST90 502646 317573857
EST91 506465 297043784
EST92 556604 189382696
EST93 522869 322432088
EST94 435722 248311319
EST95 564795 195596736
EST96 539633 245188835
EST97 565928 213590860
EST98 480163 291501652
EST99 493695 315849917
GSS1 483479 349296758
GSS10 549398 306200402
GSS11 509423 310376613
GSS12 538965 349860615
GSS13 509966 374571319
GSS14 512828 347179763
GSS15 616180 341875744
GSS16 601325 382166328
GSS17 554041 299119263
GSS18 526423 376158987
GSS19 511572 348071364
GSS2 460201 347841793
GSS20 577692 368004477
GSS21 604911 430653437
GSS22 539650 313867816
GSS23 480128 288835407
GSS24 520556 344312424
GSS25 527717 338255365
GSS26 534248 340858599
GSS27 635961 302776424
GSS28 603256 311457182
GSS29 565793 359083465
GSS3 458540 341240724
GSS30 481776 375188147
GSS31 477307 346769440
GSS32 527310 371157179
GSS33 582683 334711180
GSS34 455748 343138471
GSS35 528008 355610411
GSS36 503502 237594580
GSS37 571262 298776721
GSS38 410423 304951180
GSS39 400436 328705208
GSS4 570402 278278440
GSS40 413921 339245797
GSS41 405497 322825444
GSS42 412914 336687443
GSS43 411124 339534803
GSS44 403630 324267442
GSS45 492110 342591421
GSS46 551425 342687655
GSS47 595773 396914217
GSS48 591336 415945153
GSS49 485562 343093739
GSS5 490746 253738527
GSS50 503549 287770639
GSS51 554830 374121090
GSS52 550430 333256703
GSS53 524885 392924779
GSS54 619764 367277711
GSS55 482999 336634680
GSS56 452062 410212064
GSS57 450061 353208045
GSS58 541553 372213022
GSS59 549591 336342354
GSS6 467594 255861593
GSS60 603186 386841796
GSS61 550731 394133798
GSS62 479606 405437239
GSS63 483526 432098537
GSS64 500568 386806564
GSS65 694031 182233960
GSS66 722373 183364156
GSS67 550623 296576292
GSS68 486320 437774065
GSS69 664238 209546341
GSS7 387194 193364516
GSS70 497798 271845552
GSS71 469869 373132190
GSS72 558245 396409889
GSS73 514564 301941274
GSS74 536499 324018120
GSS75 577927 423524619
GSS76 592057 422923568
GSS77 614795 293249573
GSS78 578512 442247340
GSS79 218684 107335822
GSS8 446633 219821351
GSS9 493291 281336228
HTC1 105590 213533747
HTC2 401591 390665398
HTC3 144384 137071023
HTG1 11398 1117560132
HTG10 6350 1134106153
HTG11 7062 1123865166
HTG12 7026 1130939026
HTG13 7013 1154694359
HTG14 7057 1150125682
HTG15 6831 1156870599
HTG16 6287 1141547857
HTG17 6819 1143695002
HTG18 8686 1144543963
HTG19 9215 1092227754
HTG2 7566 1119083438
HTG20 9512 1082832923
HTG21 8342 1123201930
HTG22 7079 1136335249
HTG23 6609 1155598595
HTG24 7648 1153326826
HTG25 4369 486232722
HTG3 5928 1131528069
HTG4 5455 1141252380
HTG5 5356 1144862828
HTG6 5358 1145015310
HTG7 6607 1133078642
HTG8 6863 1144292626
HTG9 6252 1140248232
INV1 273492 651552751
INV10 166376 860253061
INV100 68 1177248763
INV100 17 1126622557
INV100 22 1147826864
INV100 9 1183449463
INV100 18 1165044863
INV100 7 1127417235
INV100 8 1105059686
INV100 10 1151181063
INV100 12 1182137373
INV100 29 1172128270
INV100 56 1161828552
INV101 97 1180579047
INV101 57 1174472938
INV101 65 1173826765
INV101 64 1169139229
INV101 67 1182079977
INV101 77 1171281279
INV101 70 1171229151
INV101 69 1176028004
INV101 34 1158731168
INV101 26 1167367926
INV101 63 1174550795
INV102 58 1169114251
INV102 79 1158142411
INV102 39 1177896784
INV102 64 1076663827
INV102 5 1042208508
INV102 49 1168521872
INV102 30 1137158099
INV102 5 1073216512
INV102 7 1125700450
INV102 10 1171368215
INV102 13 1116949082
INV103 52 1177196041
INV103 36 1173415295
INV103 63 1165975000
INV103 23 1165675019
INV103 29 1183537718
INV103 82 1180889761
INV103 97 1167943813
INV103 78 1152166277
INV103 68 1179891437
INV103 70 1174408505
INV103 32 1182126063
INV104 97 1183790244
INV104 72 1153442459
INV104 56 1176082413
INV104 27 1180882186
INV104 25 1182192511
INV104 27 1173235919
INV104 24 1047497091
INV104 6 1106587239
INV104 8 1117361023
INV104 12 1171290804
INV104 36 1102536301
INV105 52 1156907408
INV105 13 1175411375
INV105 30 1083854392
INV105 9 1122302021
INV105 55 1173221599
INV105 85 1178914939
INV105 73 1111689335
INV105 50 1182044607
INV105 106 1181002823
INV105 59 1164542291
INV105 45 1169990564
INV106 64 1183921168
INV106 47 1179405720
INV106 43 1155758692
INV106 114 1177312299
INV106 54 1182426062
INV106 110 1164528247
INV106 72 1181283395
INV106 73 1182446694
INV106 44 1062553921
INV106 10 1136013815
INV106 47 1179764874
INV107 74 1177553236
INV107 61 1180489355
INV107 41 1177194099
INV107 47 1176753516
INV107 32 1171777538
INV107 38 1143478361
INV107 11 1160223324
INV107 13 1134890516
INV107 22 1172221719
INV107 54 1173700345
INV107 9 1082368318
INV108 70 1182402345
INV108 11 1112847074
INV108 23 1180169940
INV108 94 1173167163
INV108 85 1171385185
INV108 63 986041336
INV108 1 1293457734
INV108 1 1291298704
INV108 1 1179439348
INV108 1 1160478065
INV108 1 992416756
INV109 42 1166350801
INV109 1 914908903
INV109 1 861557771
INV109 14 1170637745
INV109 70 1179993066
INV109 65 1180400965
INV109 68 1180582022
INV109 61 1167260307
INV109 47 1168264666
INV109 43 957334016
INV109 5 998238218
INV11 290 1115119161
INV110 42 1180112198
INV110 7 1162124634
INV110 26 1171141546
INV110 71 1172536328
INV110 43 1132527409
INV110 14 1107342459
INV110 4 1176433905
INV110 4 1040449989
INV110 6 1181496301
INV110 43 1177465240
INV110 73 1169539680
INV111 77 1182423323
INV111 77 1155892558
INV111 39 1145061367
INV111 20 1120353990
INV111 5 1116536280
INV111 6 1066914655
INV111 21 1153608646
INV111 15 998564496
INV111 4 988001525
INV111 5 1081838651
INV111 6 1117395520
INV112 794 1047717925
INV112 72 1182999170
INV112 10 1169370837
INV112 40 1179546201
INV112 52 1180037318
INV112 82 1171245536
INV112 54 1165543577
INV112 71 1164847361
INV112 66 1180427351
INV112 20 1114405261
INV112 10 1156831509
INV113 10 1072263170
INV113 15 1162004988
INV113 57 1182128413
INV113 51 1153077799
INV113 24 1096590343
INV113 5 1163469741
INV113 9 1119080880
INV113 14 1150018780
INV113 137 1178637528
INV113 51 1173088976
INV113 11 1183110201
INV114 10818 1091984243
INV114 11 1117753787
INV114 10 1072686594
INV114 5 1056356952
INV114 40 1175933649
INV114 81 1177754167
INV114 59 1177719070
INV114 63 1153651510
INV114 56 1150399967
INV114 43 1165976398
INV114 27 1007471769
INV115 274642 510350211
INV115 6 1175718880
INV115 7 1102063514
INV115 51 1169713973
INV115 10 1128131747
INV115 6 1157505316
INV115 34 1161696035
INV115 36 1112331387
INV115 26 1180727436
INV115 88 1182147002
INV115 101 1181328178
INV116 439172 284221630
INV116 46 1086696951
INV116 42 1164711952
INV116 48 1163490615
INV116 66 1182413025
INV116 32 1105214604
INV116 20 1180999003
INV116 58 1180357340
INV116 51 1157604163
INV116 47 1181367282
INV116 80 1163729876
INV117 451066 367288759
INV117 48 1181653551
INV117 14 777795464
INV117 3 1132529667
INV117 5 1020474505
INV117 10 1168589990
INV117 44 1168131443
INV117 22 1170806605
INV117 26 1154349099
INV117 8 1067441180
INV117 11 1125448204
INV118 426140 390715293
INV118 17 1176503653
INV118 21 1179864820
INV118 17 1147226502
INV118 15 1094932193
INV118 9 1179284571
INV118 10 1114668210
INV118 8 1148831108
INV118 12 1145267495
INV118 35 1181211300
INV118 70 1166634382
INV119 381385 438479833
INV119 7 1079580279
INV119 5 1156929815
INV119 5 1039517970
INV119 6 1096854007
INV119 7 1162526397
INV119 20 1131303307
INV119 4 1120469133
INV119 8 1167642987
INV119 22 1161995122
INV119 29 1172007080
INV12 147 1110101462
INV120 238345 993603507
INV120 78 1156217896
INV120 26 1182776393
INV120 96 1183229483
INV120 50 1180948030
INV120 42 1178359960
INV120 72 1170962823
INV120 75 1172185464
INV120 37 1167070752
INV120 15 1141317378
INV120 61 1181795182
INV121 274385 922291720
INV121 75 1163049900
INV121 173609 849544827
INV121 71711 106408780
INV122 189034 1025688353
INV123 213657 1008534562
INV124 172218 1033596367
INV125 609824 668760927
INV126 263236 977092255
INV127 309651 948309124
INV128 331703 928284570
INV129 179328 1034143013
INV13 46 1171530708
INV130 656668 724573859
INV131 186881 992647024
INV132 287816 124465316
INV133 285787 113132195
INV134 390688 319369034
INV135 377267 468947569
INV136 43 1078107310
INV137 5 1130072903
INV138 6 1081490781
INV139 49 1141328171
INV14 87 1166115197
INV140 74 1178499967
INV141 845 1161008645
INV142 38 968291429
INV143 876 1177327331
INV144 77 1168246436
INV145 73 1173763218
INV146 63 1178476210
INV147 50 1171496013
INV148 63 1179365713
INV149 77 1172336843
INV15 20 1136881416
INV150 40 1153770159
INV151 53 1169515939
INV152 27 1145716085
INV153 39 922230747
INV154 24 1180002869
INV155 58 1177487545
INV156 55 1094159933
INV157 9 1144262697
INV158 35 1162432394
INV159 71 1168651989
INV16 12 1178830433
INV160 52 1159316466
INV161 53 1182290768
INV162 126 1183465807
INV163 79 1179625942
INV164 362 1177502851
INV165 76 1178454187
INV166 60 1178307380
INV167 60 1064085029
INV168 7 978186720
INV169 23 1175930409
INV17 14 1126931892
INV170 29 1182987072
INV171 57 1128695441
INV172 41 955350349
INV173 197 1182084174
INV174 43 1173758629
INV175 30 1163071443
INV176 33 1150779494
INV177 21 1130641041
INV178 34 1165811549
INV179 69 1167363915
INV18 58 1137115496
INV180 107 1139707051
INV181 46 1144147418
INV182 64 1181555988
INV183 26 1149655799
INV184 25 1129595560
INV185 4 1063536830
INV186 36 1180705104
INV187 26 1177137263
INV188 26 1137588813
INV189 23 1162215868
INV19 132 1133664879
INV190 38 1009439894
INV191 18 1078663242
INV192 7 1139607402
INV193 63 1109671322
INV194 72 1118897610
INV195 36 1075862039
INV196 83 1177178814
INV197 90 1183295929
INV198 49 1163680138
INV199 6 1067536953
INV2 47330 1061235383
INV20 30 1024337118
INV200 45 1146467224
INV201 19 1046867413
INV202 9 1164226515
INV203 27 1135775304
INV204 133 1102741218
INV205 38 1100396957
INV206 13 1179677959
INV207 44 1180076309
INV208 57 1153107140
INV209 29 1135569658
INV21 9 1158455188
INV210 72 1177627269
INV211 51 1169733098
INV212 35 1148265513
INV213 21 978254821
INV214 37 1153788721
INV215 25 1171345473
INV216 25 1138659415
INV217 34 1171237378
INV218 54 1180751072
INV219 13 989789286
INV22 13 1057128388
INV220 26 1179421211
INV221 41 1084185462
INV222 14 1149630139
INV223 30 1172150422
INV224 12 988256607
INV225 46 1181236856
INV226 30 1071303334
INV227 10 1116962374
INV228 39 1105305998
INV229 10 1158047402
INV23 94 1168854917
INV230 58 1167006603
INV231 73 1181270472
INV232 73 1158289704
INV233 43 1174552499
INV234 96 1174494335
INV235 39 1175669524
INV236 41 1174392858
INV237 34 1017303632
INV238 20 1091394276
INV239 46 1071904885
INV24 19 1144206326
INV240 14 1173538008
INV241 53 1173770120
INV242 22 1174925624
INV243 52 1165222203
INV244 9 1135243928
INV245 37 1091829023
INV246 61 1183021647
INV247 40 1163223276
INV248 31 1154223394
INV249 45 1052580145
INV25 303 1172787628
INV250 6 1093677472
INV251 75 1080810493
INV252 6 1184020055
INV253 23 1164597292
INV254 22 1124986753
INV255 48 1121283596
INV256 43 1180336726
INV257 36 1148733597
INV258 29 1162221689
INV259 53 1178763719
INV26 163 1161177022
INV260 185 1134741007
INV261 14 1067550412
INV262 22 1169773962
INV263 42 1118586349
INV264 9 1182202232
INV265 63 1164008297
INV266 10 1160133805
INV267 10 1097001354
INV268 46 1148288042
INV269 27 1163598379
INV27 58 1164053396
INV270 60 1178007008
INV271 32 1154901090
INV272 13 1098887600
INV273 21 1149605523
INV274 33 1134762344
INV275 53 1178457892
INV276 8 1046788973
INV277 47 1183581792
INV278 23 1141449862
INV279 375 1180236783
INV28 53 1177109823
INV280 96 1139172162
INV281 19 1168497183
INV282 38 1138754106
INV283 17 1166894898
INV284 25 1094539453
INV285 25 1071893119
INV286 26 1091050727
INV287 24 1061687259
INV288 10 1056135378
INV289 16 1070828630
INV29 55 1175060825
INV290 12 1117452242
INV291 14 1123071741
INV292 19 1085845070
INV293 60 1126302065
INV294 11 1142405959
INV295 29 1173978223
INV296 61 1171216006
INV297 27 1176340908
INV298 99 1091785749
INV299 10 1128248621
INV3 177 1180760700
INV30 54 1165175634
INV300 28 1151851000
INV301 38 1156027306
INV302 50 1179318313
INV303 46 1176220893
INV304 86 1126855865
INV305 11 1150190119
INV306 18 1175856240
INV307 34 1180837817
INV308 13 1046470165
INV309 16 1179517444
INV31 54 1165175634
INV310 37 1166090880
INV311 23 1158756635
INV312 60 1148464830
INV313 56 1179257620
INV314 38 1182747184
INV315 26 1144860495
INV316 26 1164099579
INV317 55 1161028152
INV318 35 1180864303
INV319 11 492041846
INV32 52 1164163658
INV320 1 2140038457
INV321 1 1533311695
INV322 1 991394496
INV323 1 709211797
INV324 2 1097626663
INV325 3 1157353054
INV326 5 1139385694
INV327 25 1133784150
INV328 63 1181878340
INV329 101 1158086146
INV33 58 1163339042
INV330 38 1181278882
INV331 286 1183080436
INV332 45 1154854736
INV333 61 1174533348
INV334 32 1008528964
INV335 27 1174263346
INV336 64 1149369266
INV337 26 1183364031
INV338 67 1168339909
INV339 66 1147884150
INV34 55 1168957115
INV340 44 965200748
INV341 8 1166380755
INV342 39 1173103949
INV343 62 1126817827
INV344 64 1170795920
INV345 47 1172322211
INV346 10 1113379081
INV347 14 1164469949
INV348 61 1167552745
INV349 62 1125544552
INV35 69 1131367128
INV350 54 1169401059
INV351 31 1176053521
INV352 43 1171176178
INV353 14 1116220489
INV354 17 1150285064
INV355 45 1165961048
INV356 56 1112251606
INV357 15 1164046658
INV358 98 1179269248
INV359 40 1157032737
INV36 8 889788353
INV360 60 1179722234
INV361 67 1152073239
INV362 80 1180095790
INV363 48 1177743598
INV364 40 1169609794
INV365 49 1167566562
INV366 53 1180763297
INV367 64 1167962091
INV368 52 1179788115
INV369 41 1077008198
INV37 4 1008855096
INV370 8 1143611054
INV371 32 1178180889
INV372 55 1169726953
INV373 30 1143514541
INV374 42 1181985768
INV375 49 1170651243
INV376 60 1177770436
INV377 58 1163899303
INV378 48 1179283094
INV379 51 1009239312
INV38 23 1177944900
INV380 45 1170597051
INV381 33 1149912987
INV382 289 1131447836
INV383 63 1171437391
INV384 76 1168488225
INV385 62 1166044751
INV386 54 1175149356
INV387 44 1155919506
INV388 237 1056358889
INV389 17 1176712065
INV39 173 1126844149
INV390 30 1120655481
INV391 29 1165843079
INV392 39 1171071737
INV393 56 1177442728
INV394 34 1176994701
INV395 49 1167953952
INV396 73 1168533590
INV397 58 1162130134
INV398 35 1173169764
INV399 68 1169176711
INV4 26 1178079121
INV40 20 1122601317
INV400 55 1177852925
INV401 47 1183600727
INV402 48 1181899572
INV403 42 1167995858
INV404 337 1170755978
INV405 38 1163700627
INV406 51 1176507144
INV407 23 1109670578
INV408 10 1151709943
INV409 6 1065246632
INV41 41 1175741148
INV410 292 1180288671
INV411 59 1165848044
INV412 41 1163567748
INV413 12 1044631257
INV414 68 1177050385
INV415 65 1172210463
INV416 49 1161182414
INV417 53 1162135205
INV418 61 1169504490
INV419 53 1178451492
INV42 61 1139602254
INV420 54 1167857969
INV421 41 1157720543
INV422 15 1130065300
INV423 21 1172240161
INV424 23 1179640685
INV425 58 1179007315
INV426 65 1168494135
INV427 15 1170602412
INV428 68 1140944349
INV429 20 1182068121
INV43 33 1123375187
INV430 51 1161151176
INV431 289 1181800355
INV432 58 1183778194
INV433 56 1152524873
INV434 37 1181059764
INV435 33 1183150543
INV436 17 1162895880
INV437 8 1168073996
INV438 16 953821265
INV439 23 1165093501
INV44 5 1148286304
INV440 28 1178140243
INV441 26 1153570909
INV442 57 1183229295
INV443 98 1168775988
INV444 30 1175624374
INV445 48 1183765169
INV446 33 1182834679
INV447 62 1166367683
INV448 39 1159631380
INV449 47 1173723338
INV45 6 1102023018
INV450 29 1179286913
INV451 54 1120407820
INV452 49 1182565343
INV453 44 1173820162
INV454 8 1099778931
INV455 9 1112149363
INV456 6 1182219113
INV457 53 1167128077
INV458 57 1099506648
INV459 48 1183468124
INV46 5 1006822879
INV460 28 1157438427
INV461 264 1160173680
INV462 39 1150347320
INV463 32 1182321740
INV464 60 1180145995
INV465 60 1009480385
INV466 6 1089485995
INV467 7 1094680253
INV468 8 1121227790
INV469 40 1040605372
INV47 5 1013531485
INV470 24 1175286942
INV471 40 1169498334
INV472 69 1169527918
INV473 38 1167718847
INV474 46 1106067541
INV475 76 1181623637
INV476 62 1166674309
INV477 48 1128684741
INV478 7 1073869934
INV479 9 1134446170
INV48 8 1173068482
INV480 29 1155126807
INV481 36 1063228700
INV482 41 1147739941
INV483 35 1174169233
INV484 71 1171166426
INV485 63 1163209472
INV486 36 1170458138
INV487 68 1145964553
INV488 52 1183966324
INV489 68 1156021793
INV49 8 1137347641
INV490 41 1172670489
INV491 21 1170398795
INV492 70 1179432986
INV493 20 1182172308
INV494 17 1150135378
INV495 34 1035588533
INV496 9 1164322602
INV497 11 696616259
INV498 4 1098480882
INV499 17 1128239493
INV5 79 1180204163
INV50 10 1093488292
INV500 46 1163147483
INV501 31 1166555587
INV502 18 1170697502
INV503 54 1183402121
INV504 36 1116252282
INV505 15 1175006159
INV506 53 1134197867
INV507 39 1160762091
INV508 6 784756776
INV509 13 1180329439
INV51 8 1132990028
INV510 23 1176174170
INV511 16 1154965186
INV512 15 1140373678
INV513 19 1165846000
INV514 25 1165673556
INV515 35 1091962304
INV516 45 1146902933
INV517 78 1166964687
INV518 86 1180374172
INV519 62 1158067952
INV52 5 1023016328
INV520 20 1152935285
INV521 28 1153368036
INV522 23 1115796990
INV523 13 1159346242
INV524 43 1181378857
INV525 37 1169051928
INV526 35 1181587883
INV527 19 1105257605
INV528 41 1175491415
INV529 246 1134359555
INV53 7 1125698044
INV530 73 1162154948
INV531 42 1171899175
INV532 64 1182150917
INV533 61 1182594997
INV534 39 1172872119
INV535 49 1146195324
INV536 11 1057543841
INV537 7 1014602742
INV538 7 1107402104
INV539 19 1154917770
INV54 4 976051363
INV540 95 1173818277
INV541 7 1115785790
INV542 23 1036981527
INV543 8 1167420667
INV544 167 1122798086
INV545 31 1170423181
INV546 61 1072140099
INV547 12 1138976695
INV548 52 1179942942
INV549 40 1164292766
INV55 5 1140405738
INV550 19 1136158039
INV551 20 1144004416
INV552 54 1165837308
INV553 35 1078430477
INV554 10 1178565949
INV555 103 1177126579
INV556 70 1163288709
INV557 37 1094738481
INV558 7 1063903586
INV559 5 1033425372
INV56 6 998008237
INV560 5 1133793345
INV561 6 1097022162
INV562 10 1144083606
INV563 15 1178286721
INV564 56 1151206074
INV565 40 1178349688
INV566 212 1125947535
INV567 64 1165292200
INV568 48 1173158005
INV569 98 1180185400
INV57 4 1129459162
INV570 27 1016054183
INV571 7 1084999665
INV572 22 1159672490
INV573 79 1180045721
INV574 34 1180395502
INV575 24 1176439710
INV576 31 1175918517
INV577 60 1173881038
INV578 33 1183137119
INV579 40 1101227863
INV58 5 1149387774
INV580 13 1172407254
INV581 10 1133270109
INV582 17 1160986959
INV583 63 1172188697
INV584 54 1170794397
INV585 48 1051005091
INV586 6 1070516134
INV587 8 1118290074
INV588 45 1146385407
INV589 46 1174606946
INV59 11 1170016119
INV590 39 1180186297
INV591 14 1154040621
INV592 42 1175882988
INV593 13 1082868413
INV594 9 1097592820
INV595 12 1151483778
INV596 20 1178884046
INV597 54 1183961763
INV598 24 1154215854
INV599 36 1160641988
INV6 175 1135542232
INV60 86997 1045586099
INV600 60 1177039901
INV601 38 947745255
INV602 38 1164056076
INV603 19 968254082
INV604 5 1135738023
INV605 46 1175547441
INV606 32 956576233
INV607 7 1137083933
INV608 201 1166190476
INV609 38 1182578625
INV61 397078 495224984
INV610 17 1183129312
INV611 26 1163552733
INV612 20 1135116210
INV613 26 1157264987
INV614 36 1165361880
INV615 25 1068168358
INV616 8 1153759493
INV617 13 1168468854
INV618 41 1165774021
INV619 8 1116094366
INV62 2945 1142383510
INV620 27 1179116268
INV621 54 1175536841
INV622 44 890161313
INV623 30 1158313566
INV624 9 1064619624
INV625 43 1157155112
INV626 59 1183785476
INV627 46 1178984177
INV628 50 1170246046
INV629 40 1175116562
INV63 81 1181842916
INV630 57 1150518809
INV631 34 1182961037
INV632 67 1171683919
INV633 32 1036846468
INV634 41 1175776049
INV635 59 1158249913
INV636 57 1181123187
INV637 54 1165591773
INV638 24 1157528745
INV639 16 1154368054
INV64 57 1181391851
INV640 51 1166471254
INV641 27 1124653331
INV642 14 1159484511
INV643 22 1182454075
INV644 17 1003622594
INV645 6 1027416730
INV646 21 1161892934
INV647 50 831753780
INV648 4 1089471972
INV649 9 1101980534
INV65 56 1171400533
INV650 44 1175702680
INV651 41 1131505858
INV652 10 1066812585
INV653 4 980796239
INV654 20 1183594436
INV655 43 1163249106
INV656 47 1144061752
INV657 10 1165110718
INV658 62 1179093290
INV659 52 1180864361
INV66 102 1177935211
INV660 47 1159707827
INV661 12 1023645300
INV662 3 1157463834
INV663 3 1060904444
INV664 4 1181112588
INV665 15 1171997463
INV666 28 938338623
INV667 5 1137688336
INV668 16 1154482827
INV669 50 1180339018
INV67 51 1132514880
INV670 31 1179713034
INV671 31 1098347645
INV672 8 1160538827
INV673 18 1021456030
INV674 2 1006091031
INV675 2 951616379
INV676 2 871667885
INV677 2 818376178
INV678 3 1052261518
INV679 3 939543120
INV68 70 1177732067
INV680 32 1090180866
INV681 6 1170627702
INV682 32 1053262233
INV683 8 1121167788
INV684 9 1108544100
INV685 11 1152684900
INV686 14 1154185609
INV687 38 1134271676
INV688 19 1177658696
INV689 44 1177518978
INV69 248559 732474676
INV690 22 1079647998
INV691 11 1179569133
INV692 5 887314561
INV693 1 690419613
INV694 1 688810701
INV695 1 639929110
INV696 1 625027500
INV697 1 623195831
INV698 1 617718696
INV699 2 1167479169
INV7 63 1175727174
INV70 30791 1125605131
INV700 2 1124973432
INV701 2 972905134
INV702 6 1143958739
INV703 41 1179501029
INV704 39 1145476693
INV705 14 1142072413
INV706 21 1176695123
INV707 31 1172264547
INV708 62 1137054351
INV709 27 1175819084
INV71 105 1182141123
INV710 23 891961094
INV711 9 1167542534
INV712 67 1134243551
INV713 26 1029705715
INV714 3 1143035150
INV715 43 1165738581
INV716 12 1137462971
INV717 5 1072259877
INV718 7 1180876279
INV719 35 1175805876
INV72 85 1166351081
INV720 18 1093802415
INV721 22 1176383333
INV722 57 1183010513
INV723 53 1179327736
INV724 21 1167194720
INV725 40 1176398187
INV726 42 1147439138
INV727 27 1168321087
INV728 23 1166281917
INV729 33 1151216138
INV73 82 1172177036
INV730 18 1000323493
INV731 25 1183567352
INV732 37 1092604927
INV733 195 1163550044
INV734 33 950798212
INV735 30 1152607316
INV736 37 1165714265
INV737 33 1068556053
INV738 11 1115976464
INV739 27 1161045343
INV74 168 1164653127
INV740 35 1171844836
INV741 33 1159525911
INV742 41 1180390883
INV743 11 1024131553
INV744 9 1085975686
INV745 42 1147992208
INV746 37 1181637273
INV747 38 1081813347
INV748 3 1174046842
INV749 20 1178261379
INV75 66 1136325215
INV750 46 1178413119
INV751 13 1142733896
INV752 10 1130174875
INV753 22 1175825264
INV754 19 1163517885
INV755 18 1152640158
INV756 15 1147311777
INV757 11 1091619980
INV758 38 1170155090
INV759 29 1173715878
INV76 77 1156622164
INV760 35 835977582
INV761 2 940631047
INV762 2 928744483
INV763 2 883129211
INV764 3 1143834446
INV765 4 1134397883
INV766 250 1171544750
INV767 44 1136955202
INV768 10 1154316587
INV769 49 1174737284
INV77 81 1182492784
INV770 29 1166236126
INV771 12 1175327206
INV772 45 1153063095
INV773 36 1105816193
INV774 51 1142429844
INV775 33 1069665695
INV776 39 1139985500
INV777 32 1175690890
INV778 20 1132543617
INV779 24 1176271695
INV78 71 1178216189
INV780 63 1133933129
INV781 142 1139463992
INV782 36 1181524309
INV783 24 1115387771
INV784 49 1150209817
INV785 20 1083179547
INV786 8 1098795584
INV787 10 1147577596
INV788 12 1181888711
INV789 27 1175290982
INV79 63 1175787321
INV790 40 1060130206
INV791 8 1129793124
INV792 40 1160847583
INV793 31 1180662633
INV794 30 1171761940
INV795 25 1081426888
INV796 18 1003956340
INV797 5 1028031751
INV798 8 1084093438
INV799 9 1085930053
INV8 39 1090025455
INV80 98 1140230479
INV800 12 1156139919
INV801 16 1152066914
INV802 34 1175667989
INV803 70 1176610322
INV804 24 1179259380
INV805 11 1105396847
INV806 12 1115650974
INV807 13 1176755746
INV808 35 1182242624
INV809 13 962698360
INV81 339360 537238748
INV810 4 998118856
INV811 11 1172986735
INV812 34 1119944490
INV813 51 1169563167
INV814 13 1118920573
INV815 72 1179683902
INV816 79 1118509722
INV817 7 1078681531
INV818 11 1179163002
INV819 22 789281094
INV82 454318 329141440
INV820 4 1079695977
INV821 9 1111645608
INV822 16 1182708412
INV823 31 1103328307
INV824 25 853793460
INV825 7 1129785984
INV826 19 1105886509
INV827 9 1143534659
INV828 13 1174582815
INV829 69 1175357321
INV83 457203 340026238
INV830 80 1153031168
INV831 41 1164065325
INV832 61 1162032954
INV833 40 1123882437
INV834 9 1130047032
INV835 11 1116235507
INV836 13 1126566723
INV837 28 1172489440
INV838 51 1136459610
INV839 12 1062372964
INV84 442896 301914356
INV840 10 1112670569
INV841 68 1181896580
INV842 71 1177368065
INV843 65 1111204596
INV844 15 1173116435
INV845 37 1142589085
INV846 12 1124247542
INV847 19 1161505884
INV848 24 1171403553
INV849 41 1165677686
INV85 424702 260555698
INV850 20 1180506747
INV851 15 1170391368
INV852 42 1165980829
INV853 40 1171861906
INV854 36 1077524818
INV855 9 1047907154
INV856 8 1141384454
INV857 15 1168272058
INV858 61 1178023607
INV859 65 1170721200
INV86 418913 263107005
INV860 14 1053590254
INV861 10 1057950276
INV862 8 1127887377
INV863 4 1020160878
INV864 7 1147749005
INV865 33 1176769105
INV866 20 1168205515
INV867 12 1141663061
INV868 39 1171208474
INV869 9 974544864
INV87 430951 328107954
INV870 10 1175733994
INV871 39 1166578258
INV872 29 1161961409
INV873 21 1037891489
INV874 25 1178490259
INV875 53 1169873765
INV876 86 1176021019
INV877 75 1177037179
INV878 32 1151881647
INV879 8 1135911959
INV88 415159 528460212
INV880 8 919810433
INV881 3 1139338401
INV882 3 972340244
INV883 4 1157140290
INV884 5 1126736368
INV885 31 1182264396
INV886 66 1178364544
INV887 35 1034534722
INV888 44 1177143306
INV889 43 1083170751
INV89 389319 813402808
INV890 9 1127837545
INV891 49 1177583056
INV892 70 1183935958
INV893 70 1175817111
INV894 48 1144611323
INV895 20 1130825940
INV896 84 1178249363
INV897 74 1171197019
INV898 50 1179606929
INV899 78 1175655092
INV9 15 1161003619
INV90 205985 909544157
INV900 75 1173593307
INV901 30 1132766399
INV902 13 1149268122
INV903 55 1173118698
INV904 57 1183964102
INV905 72 1163162176
INV906 69 1170172550
INV907 55 1171372002
INV908 69 1174685523
INV909 49 1059075259
INV91 313253 842219824
INV910 11 1138880319
INV911 21 1180633677
INV912 52 1182842349
INV913 20 1136109675
INV914 59 1166902771
INV915 67 1180049046
INV916 60 1152975227
INV917 26 1174031121
INV918 49 1182264063
INV919 37 1167508597
INV92 3828 1125050901
INV920 82 1173831360
INV921 70 1181974399
INV922 57 1148872951
INV923 40 1169598662
INV924 22 1122949879
INV925 11 1173320112
INV926 82 1180802772
INV927 83 1179519663
INV928 70 1181909064
INV929 51 1150708751
INV93 956 1156080361
INV930 7 1146761823
INV931 8 1055443050
INV932 53 1177806892
INV933 86 1172323872
INV934 84 1180311193
INV935 73 1164334570
INV936 72 1183223171
INV937 67 1162390553
INV938 55 1182871381
INV939 34 1184074510
INV94 10436 1116731609
INV940 27 1157545289
INV941 29 1161972265
INV942 58 1177882987
INV943 65 1180837664
INV944 80 1180893864
INV945 27 1164634991
INV946 25 1163917876
INV947 21 1135242236
INV948 86 1179798276
INV949 67 1176878455
INV95 251 1062752027
INV950 51 1167587975
INV951 20 1107295341
INV952 48 1166998486
INV953 37 1141131615
INV954 39 1178888356
INV955 65 1179881145
INV956 31 1149916497
INV957 79 1182580014
INV958 84 1169638868
INV959 48 1171495920
INV96 571 1090398689
INV960 72 1172468481
INV961 65 1172923430
INV962 87 1174809060
INV963 66 1138385327
INV964 55 1157177408
INV965 41 1183767190
INV966 54 1145403994
INV967 13 1177483908
INV968 17 1163670499
INV969 18 1087617850
INV97 62301 1081955980
INV970 10 1102334196
INV971 32 1165661141
INV972 78 1176142905
INV973 69 1174487870
INV974 42 1172705966
INV975 55 1183806990
INV976 43 1171825405
INV977 29 1126047347
INV978 24 1165054152
INV979 55 1178862848
INV98 65 1182992628
INV980 47 1148163762
INV981 5 1067443809
INV982 14 1169822539
INV983 66 1172480678
INV984 66 1177353082
INV985 69 1162958016
INV986 31 1164230050
INV987 32 1148823264
INV988 20 1152598456
INV989 7 1043196064
INV99 82 1170643469
INV990 9 1017702910
INV991 5 1022661575
INV992 6 1037507473
INV993 7 1047450933
INV994 9 1131078777
INV995 38 1183586240
INV996 22 1106444411
INV997 44 1175827194
INV998 49 1180628303
INV999 42 1183827936
MAM1 54649 917178765
MAM10 17 1127029450
MAM100 18 998024221
MAM101 9 1129296049
MAM102 53 1144597149
MAM103 9 1076958295
MAM104 10 1091212439
MAM105 10 1183156498
MAM106 16 1135846769
MAM107 8 1092852495
MAM108 17 1061340501
MAM109 7 1070781583
MAM11 18 1142664549
MAM110 12 1145013723
MAM111 8 1169519331
MAM112 12 1133392046
MAM113 12 1071796151
MAM114 12 1184021614
MAM115 16 1006581790
MAM116 5 1017575367
MAM117 8 1092520245
MAM118 21 1083014647
MAM119 13 1112078254
MAM12 15 1132274725
MAM120 17 1118758367
MAM121 13 1165846276
MAM122 18 1100393997
MAM123 8 1179792582
MAM124 14 1041093991
MAM125 5 1164514221
MAM126 10 1172455048
MAM127 7 1165637199
MAM128 9 1082208304
MAM129 7 1132943029
MAM13 9 1181471817
MAM130 9 1122466917
MAM131 6 999063376
MAM132 5 1043899296
MAM133 9 1183016709
MAM134 14 1158872058
MAM135 14 1170139353
MAM136 11 1110325951
MAM137 11 1159492295
MAM138 11 1173441240
MAM139 14 1120745545
MAM14 14 1173406720
MAM140 9 1088893088
MAM141 12 1099118976
MAM142 17 1182972727
MAM143 12 1124668268
MAM144 16 1139882797
MAM145 9 1180843934
MAM146 16 1130346730
MAM147 7 1147471451
MAM148 14 1157587755
MAM149 5 1073397237
MAM15 10 1131536607
MAM150 10 1173167440
MAM151 12 1165618356
MAM152 18 986700581
MAM153 7 1128061078
MAM154 12 1157534009
MAM155 11 1137571448
MAM156 9 1104150082
MAM157 12 1128267746
MAM158 18 1031989209
MAM159 5 1040560864
MAM16 14 1173052009
MAM160 9 1110923230
MAM161 11 1042773086
MAM162 10 1163642923
MAM163 14 1096293543
MAM164 13 1158593680
MAM165 12 1076013962
MAM166 7 1091208733
MAM167 9 1052186052
MAM168 8 1120217491
MAM169 13 1060478359
MAM17 12 1057388218
MAM170 9 1151984057
MAM171 15 1083596101
MAM172 7 1108781520
MAM173 18058 871040529
MAM18 10 1098097203
MAM19 15 1026611779
MAM2 7 1177030125
MAM20 6 1069522997
MAM21 12 1147180873
MAM22 13 1089172779
MAM23 8 1147102555
MAM24 17 1161495983
MAM25 7 1160364752
MAM26 14 1119860958
MAM27 12 1168070061
MAM28 11 1147190445
MAM29 16 1179712380
MAM3 45056 812377816
MAM30 10 1156184385
MAM31 16 1138379370
MAM32 9 1133234150
MAM33 12 1136792441
MAM34 14 1083174451
MAM35 10 1114325055
MAM36 16 1100855100
MAM37 8 1087010659
MAM38 12 1132313879
MAM39 86264 1052145122
MAM4 5 977148124
MAM40 67627 1075397459
MAM41 20 1168721798
MAM42 260403 628379768
MAM43 1 716413629
MAM44 1 662751787
MAM45 2 1076242322
MAM46 6 1060323989
MAM47 7 1157094405
MAM48 374 1047383769
MAM49 11 1148682982
MAM5 13 1070912825
MAM50 270 1107760733
MAM51 16 1096674869
MAM52 11 1153008662
MAM53 15 1183890503
MAM54 3346 1174847022
MAM55 211277 665757142
MAM56 14 1092077466
MAM57 14 1163101092
MAM58 283 1113603904
MAM59 9 1139689185
MAM6 13 1061705218
MAM60 400 1104705819
MAM61 8 1083688240
MAM62 36 1141428289
MAM63 10 1174298463
MAM64 17 1141584519
MAM65 9 1177791867
MAM66 12 1142868678
MAM67 278 1016632173
MAM68 8 1175859851
MAM69 13 1079428393
MAM7 15 1160135387
MAM70 8 1131775367
MAM71 14 1079277413
MAM72 11 1080315572
MAM73 17 1101712135
MAM74 13 1051005117
MAM75 10 1174291860
MAM76 10 1119665667
MAM77 9 1183872739
MAM78 17 1024269365
MAM79 9 1137930415
MAM8 20 1124934750
MAM80 14 1061883364
MAM81 8 1162431176
MAM82 14 1127176217
MAM83 7 1104289556
MAM84 10 1116587684
MAM85 15 1090723901
MAM86 16 1130864720
MAM87 13 1059549871
MAM88 10 1183235581
MAM89 15 1154898355
MAM9 21 1147650305
MAM90 12 1149723292
MAM91 165 1085909386
MAM92 13 1183728650
MAM93 22 1141158435
MAM94 8 1144438750
MAM95 12 1181431425
MAM96 12 1133730981
MAM97 10 1140589415
MAM98 9 1113504619
MAM99 12 1141683482
PAT1 1093033 539683340
PAT10 688443 489276188
PAT11 677201 371944349
PAT12 520569 625174972
PAT13 707192 313512775
PAT14 603508 512090486
PAT15 1067063 29472194
PAT16 1081381 20546239
PAT17 1015193 597235042
PAT18 1080050 409382449
PAT19 1268029 483798152
PAT2 771018 511588747
PAT20 957948 647777156
PAT21 700573 783028061
PAT22 957467 615694279
PAT23 1205754 433132776
PAT24 1105926 360281630
PAT25 872506 449035163
PAT26 1586759 64031367
PAT27 1019180 511837383
PAT28 1070484 563952971
PAT29 886304 639311305
PAT3 745617 413111586
PAT30 761696 641000999
PAT31 633845 417084151
PAT32 497125 560581445
PAT33 727523 277686075
PAT34 285756 357061083
PAT35 588064 306800009
PAT36 961836 373081348
PAT37 537105 782997081
PAT38 969587 455187654
PAT39 1548539 54896773
PAT4 842806 549266577
PAT40 794890 680460754
PAT41 634643 560451533
PAT42 298174 613720394
PAT43 440312 290616054
PAT44 889645 200469857
PAT45 1073922 350037308
PAT46 722304 158194427
PAT47 562170 295354562
PAT48 436636 272415650
PAT49 683698 337133782
PAT5 692730 426144973
PAT50 548223 230180169
PAT51 636341 205206554
PAT52 457424 602428944
PAT53 384810 506982033
PAT54 762396 200710229
PAT55 602886 167459728
PAT56 253407 374210379
PAT57 862313 110750583
PAT58 961337 332036811
PAT59 776383 723417163
PAT6 748944 287585999
PAT60 566980 857437963
PAT61 661773 800495331
PAT62 746863 713758780
PAT63 990081 532292232
PAT64 707389 772084652
PAT65 730648 766263060
PAT66 756664 723875246
PAT67 459726 836540752
PAT68 704205 316880531
PAT69 847025 63837655
PAT7 704534 359977292
PAT70 853182 51598492
PAT71 873096 312174056
PAT72 743119 740743755
PAT73 755340 755945115
PAT74 1137682 489266844
PAT75 729206 240496092
PAT76 584438 410183394
PAT77 596598 459637580
PAT78 535251 362797043
PAT79 695675 285270670
PAT8 717602 514522635
PAT80 793663 388921364
PAT81 655579 626127981
PAT9 936351 600427711
PHG1 18886 659328394
PHG2 16406 686687415
PHG3 16555 415461249
PLN1 182392 828396816
PLN10 121 1176725979
PLN100 49 1182120568
PLN100 1 662624081
PLN100 1 626502968
PLN100 1 614857888
PLN100 2 1161694293
PLN100 2 1153142705
PLN100 1 669220190
PLN100 1 629226312
PLN100 1 613110551
PLN100 2 1144904879
PLN100 2 1160236768
PLN101 43 1182331514
PLN101 1 658438119
PLN101 1 628047470
PLN101 1 612916554
PLN101 2 1143852611
PLN101 2 1150763450
PLN101 1 657631428
PLN101 1 629616096
PLN101 1 610488678
PLN101 2 1145704528
PLN101 2 1148031132
PLN102 43 1175719222
PLN102 1 655385637
PLN102 1 626286153
PLN102 1 610690180
PLN102 2 1141737084
PLN102 2 1145450335
PLN102 1 659936173
PLN102 1 627661034
PLN102 1 608478632
PLN102 2 1164887918
PLN102 2 1157801119
PLN103 43 1183406182
PLN103 1 654540277
PLN103 1 624453744
PLN103 1 610565479
PLN103 2 1154225896
PLN103 2 1144646810
PLN103 1 661109612
PLN103 1 624188817
PLN103 1 609603980
PLN103 2 1153106963
PLN103 2 1149274143
PLN104 42 1163229317
PLN104 1 657668641
PLN104 1 627263816
PLN104 1 611107145
PLN104 2 1143888586
PLN104 2 1151475536
PLN104 1 659552134
PLN104 1 627284235
PLN104 1 612025601
PLN104 2 1148289352
PLN104 2 1155467049
PLN105 44 1182265834
PLN105 1 660627594
PLN105 1 636764043
PLN105 1 612684114
PLN105 2 1172404752
PLN105 2 1143811555
PLN105 1 660087335
PLN105 1 626870575
PLN105 1 607666773
PLN105 2 1160190638
PLN105 2 1151319163
PLN106 82 1008208987
PLN106 1 663157241
PLN106 1 626857742
PLN106 1 607587567
PLN106 2 1166417974
PLN106 2 1149892400
PLN106 1 660726353
PLN106 1 625613366
PLN106 1 606853752
PLN106 2 1145435293
PLN106 2 1148608716
PLN107 2 747319580
PLN107 1 659649991
PLN107 1 630477981
PLN107 1 612914000
PLN107 2 1159094545
PLN107 2 1155390937
PLN107 1 657190419
PLN107 1 626766831
PLN107 1 610506001
PLN107 2 1139699259
PLN107 2 1151798322
PLN108 2 884812093
PLN108 1 659109138
PLN108 1 625619081
PLN108 1 605020174
PLN108 2 1144201423
PLN108 2 1150772597
PLN108 1 660123737
PLN108 1 626033862
PLN108 1 611584699
PLN108 2 1146634294
PLN108 1 629468067
PLN109 2 918639035
PLN109 2 1181536715
PLN109 1 634780758
PLN109 1 613857241
PLN109 2 1153523653
PLN109 2 1157943603
PLN109 1 655608708
PLN109 1 630476109
PLN109 1 611734907
PLN109 2 1148834704
PLN109 2 1153026048
PLN11 81 1074115299
PLN110 7 1170902936
PLN110 1 660958633
PLN110 1 628850999
PLN110 1 613418293
PLN110 2 1149130062
PLN110 2 1149230152
PLN110 1 662192201
PLN110 1 624651312
PLN110 1 607896916
PLN110 2 1144733231
PLN110 2 1148913967
PLN111 28 1037362098
PLN111 1 659736604
PLN111 1 626336238
PLN111 1 607408596
PLN111 2 1149881386
PLN111 2 1156807113
PLN111 1 662539114
PLN111 1 634696490
PLN111 1 614659814
PLN111 2 1155079160
PLN111 2 1150818685
PLN112 2 746994619
PLN112 1 657222892
PLN112 1 629605540
PLN112 1 613053250
PLN112 2 1144594366
PLN112 2 1153001227
PLN112 1 663034619
PLN112 1 623546353
PLN112 1 613383894
PLN112 2 1145099380
PLN112 21 1178182689
PLN113 2 884447165
PLN113 43 1173368751
PLN113 16 1115226327
PLN113 5 955353777
PLN113 3 875632936
PLN113 2 877648901
PLN113 3 1033679662
PLN113 34 1141347588
PLN113 12 848648943
PLN113 1 655484837
PLN113 1 626855960
PLN114 2 918277773
PLN114 1 604911185
PLN114 2 1146256337
PLN114 2 1152814527
PLN114 1 631897805
PLN114 1 637173558
PLN114 1 641960388
PLN114 2 1176182574
PLN114 2 1155488842
PLN114 1 660305412
PLN114 1 629753639
PLN115 31 1165164536
PLN115 1 609200707
PLN115 2 1175561398
PLN115 2 1154972860
PLN115 1 659208678
PLN115 1 627226266
PLN115 1 603942392
PLN115 2 1145038912
PLN115 2 1141862336
PLN115 1 661554418
PLN115 1 627699516
PLN116 30 1167366437
PLN116 1 609498991
PLN116 2 1148139209
PLN116 51 1161837995
PLN116 39 664623668
PLN116 2 961863683
PLN116 1 639092456
PLN116 2 1152889042
PLN116 1 616552515
PLN116 1 734473537
PLN116 2 1100022842
PLN117 45 1167105526
PLN117 2 990953513
PLN117 2 1156725275
PLN117 2 921884013
PLN117 2 954999066
PLN117 1 602817757
PLN117 2 1122645515
PLN117 35 1172890850
PLN117 34 1181509311
PLN117 92 1151713734
PLN117 41 782214027
PLN118 32 1137254786
PLN118 1 663523538
PLN118 1 635405230
PLN118 1 611936476
PLN118 2 1150154113
PLN118 2 1161072711
PLN118 1 660736956
PLN118 1 627598042
PLN118 1 612187513
PLN118 2 1155070448
PLN118 2 1145745297
PLN119 17 1149535900
PLN119 1 673406957
PLN119 1 630137118
PLN119 1 612939186
PLN119 2 1151335502
PLN119 2 1155631783
PLN119 1 657661460
PLN119 1 626889213
PLN119 1 610003100
PLN119 2 1148528258
PLN119 2 1146029239
PLN12 23 1134451674
PLN120 21 1155383232
PLN120 1 662475302
PLN120 1 630354994
PLN120 1 612387238
PLN120 2 1155754903
PLN120 2 1149070389
PLN120 1 653250953
PLN120 1 631324550
PLN120 1 609093722
PLN120 2 1149523883
PLN120 2 1145083390
PLN121 77 1140690999
PLN121 1 655260812
PLN121 1 634191159
PLN121 1 614681618
PLN121 2 1172767975
PLN121 2 1152836532
PLN121 1 658721539
PLN121 1 626163282
PLN121 1 609194012
PLN121 2 1153379980
PLN121 2 1162676726
PLN122 31 1152653146
PLN122 1 656359106
PLN122 1 622273932
PLN122 1 610730036
PLN122 2 1152019255
PLN122 2 1150333174
PLN122 1 657708949
PLN122 1 625240013
PLN122 1 610861510
PLN122 2 1136292166
PLN122 2 1152354408
PLN123 29 1155649750
PLN123 1 657289215
PLN123 1 624169276
PLN123 1 611474174
PLN123 2 1152158626
PLN123 2 1154678582
PLN123 1 664634244
PLN123 1 643202471
PLN123 1 617103718
PLN123 2 1161114768
PLN123 2 1163751838
PLN124 18 1163390621
PLN124 1 660262686
PLN124 1 634680428
PLN124 1 612896067
PLN124 2 1153985512
PLN124 2 1159127655
PLN124 1 658111403
PLN124 1 631828453
PLN124 1 612358733
PLN124 2 1172628206
PLN124 2 1161043722
PLN125 72 1167679333
PLN125 1 661402595
PLN125 1 635870417
PLN125 1 617906818
PLN125 2 1154505804
PLN125 2 1161723662
PLN125 1 666500271
PLN125 1 632086707
PLN125 1 607961820
PLN125 2 1173780312
PLN125 21 1134943785
PLN126 21 1165844226
PLN126 29 1167338095
PLN126 33 1171528235
PLN126 12 1152489829
PLN126 92 1120024293
PLN126 30 1144069965
PLN126 31 1131160060
PLN126 37 1171331343
PLN126 18 1137163367
PLN126 18 1108681313
PLN126 11 1140492879
PLN127 35 1139226173
PLN127 14 1175056220
PLN127 51 1162077512
PLN127 14 989011425
PLN127 4 968685916
PLN127 4 989422041
PLN127 4 1035905487
PLN127 4 964344820
PLN127 4 1168659054
PLN127 5 1115864637
PLN127 18 1160077621
PLN128 31 1159550172
PLN128 33 1000994116
PLN128 1 2143528264
PLN128 1 2138631366
PLN128 1 2132989935
PLN128 1 2142145023
PLN128 1 2142779784
PLN128 1 124381055
PLN128 1 2112395848
PLN128 1 2144481838
PLN128 1 2133121580
PLN129 184 1018426412
PLN129 1 2141806609
PLN129 1 1870266305
PLN129 1 2134931027
PLN129 1 2108664250
PLN129 1 2146278775
PLN129 1 2117022170
PLN129 1 1576301307
PLN129 1 2067099338
PLN129 1 2134690998
PLN129 1 2136662657
PLN13 23 1086303057
PLN130 31 1079682761
PLN130 1 2140543523
PLN130 1 1531582847
PLN130 1 2146571508
PLN130 1 2138192289
PLN130 1 2101175359
PLN130 1 2146227213
PLN130 1 621086779
PLN130 1 2138605540
PLN130 1 2083688238
PLN130 1 2144314009
PLN131 92 1140046612
PLN131 1 2139184679
PLN131 1 172723629
PLN131 1 2132146989
PLN131 1 2133919239
PLN131 1 2133305249
PLN131 1 2100933269
PLN131 1 143347570
PLN131 1 2134142781
PLN131 1 2145201137
PLN131 1 2137733646
PLN132 25 1059846954
PLN132 1 1914313492
PLN132 1 2145479601
PLN132 1 2114166385
PLN132 1 2146417222
PLN132 1 1555468501
PLN132 1 2141253099
PLN132 1 2119186544
PLN132 1 2142175433
PLN132 1 1498831827
PLN132 9 1052661862
PLN133 8 1144483866
PLN133 13 1137925323
PLN133 34 858656987
PLN133 2 1034251136
PLN133 2 1041322427
PLN133 2 959575375
PLN133 2 1005137949
PLN133 2 1136683915
PLN133 2 1019386330
PLN133 3 1015418383
PLN133 2 1022027198
PLN134 120 1140276692
PLN134 2 1025363455
PLN134 2 931056427
PLN134 2 969293345
PLN134 2 1064158730
PLN134 2 968690797
PLN134 3 980008249
PLN134 2 1043031688
PLN134 2 1031876872
PLN134 2 943080858
PLN134 2 1000998827
PLN135 32 1162161673
PLN135 2 1157028134
PLN135 2 1004786053
PLN135 3 985677594
PLN135 2 1014843260
PLN135 2 1068644986
PLN135 2 948335936
PLN135 2 879747037
PLN135 2 1127570290
PLN135 2 990438732
PLN135 3 875786730
PLN136 40 1145602937
PLN136 2 991559490
PLN136 2 942009307
PLN136 2 906129229
PLN136 2 936264359
PLN136 2 928886758
PLN136 2 935093463
PLN136 2 930365420
PLN136 2 990803747
PLN136 2 885021138
PLN136 2 908456347
PLN137 126 1101917744
PLN137 2 930959077
PLN137 2 1041934893
PLN137 2 942999660
PLN137 3 908571112
PLN137 2 994915609
PLN137 2 1008745383
PLN137 2 850230395
PLN137 2 915695621
PLN137 2 1025227490
PLN137 2 862764790
PLN138 20 1137915710
PLN138 2 884517818
PLN138 2 958486939
PLN138 2 882430803
PLN138 2 805094337
PLN138 2 912116412
PLN138 2 1080442405
PLN138 2 903251998
PLN138 3 846587112
PLN138 2 997148082
PLN138 2 1024702898
PLN139 19 1043020505
PLN139 3 1046276430
PLN139 2 960152348
PLN139 2 997566044
PLN139 2 926826996
PLN139 2 970728340
PLN139 2 1076556621
PLN139 2 961846356
PLN139 3 1105984004
PLN139 2 1091311779
PLN139 2 928973494
PLN14 85750 1022222900
PLN140 96 1183697400
PLN140 4 966977223
PLN140 2 1034513146
PLN140 2 973973117
PLN140 2 836784321
PLN140 2 990350501
PLN140 2 1034765442
PLN140 2 918838269
PLN140 2 998373654
PLN140 2 1023553300
PLN140 2 914623388
PLN141 37 1079301244
PLN141 2 836746646
PLN141 2 993956991
PLN141 2 952571408
PLN141 2 873792954
PLN141 3 942162386
PLN141 2 990124494
PLN141 2 909364021
PLN141 2 882617017
PLN141 2 897026796
PLN141 2 1002960583
PLN142 3 811910418
PLN142 2 873235512
PLN142 2 976812402
PLN142 2 1096125550
PLN142 2 964192102
PLN142 2 869744809
PLN142 2 940385236
PLN142 2 956987604
PLN142 2 893651928
PLN142 11 1138345400
PLN142 17 1160613983
PLN143 3 987843021
PLN143 17 1152282495
PLN143 17 1161769737
PLN143 17 1137473602
PLN143 16 1149378136
PLN143 17 1140788494
PLN143 17 1173897061
PLN143 17 1169465378
PLN143 9 1142566106
PLN143 1 827770304
PLN143 1 819590567
PLN144 13 1147553433
PLN144 1 657919172
PLN144 1 735222392
PLN144 1 640551262
PLN144 2 850883630
PLN144 1 641523445
PLN144 1 830702509
PLN144 1 817725293
PLN144 1 657518596
PLN144 1 728079018
PLN144 1 637620844
PLN145 30 1169021303
PLN145 2 841520699
PLN145 2 787615973
PLN145 2 1005487930
PLN145 2 870370402
PLN145 2 954925343
PLN145 2 877145967
PLN145 2 915888348
PLN145 2 951785915
PLN145 2 976596859
PLN145 2 981034558
PLN146 43 1175210350
PLN146 2 853229614
PLN146 2 968208187
PLN146 2 1065368112
PLN146 2 928206292
PLN146 3 960272742
PLN146 2 1022027198
PLN146 2 1025363455
PLN146 2 931056427
PLN146 2 969293345
PLN146 2 1064158730
PLN147 27 1138426334
PLN147 2 968690797
PLN147 3 980008249
PLN147 2 991559490
PLN147 2 942009307
PLN147 2 906129229
PLN147 2 936264359
PLN147 2 928886758
PLN147 2 935093463
PLN147 2 930365420
PLN147 2 990803747
PLN148 25 1148725445
PLN148 2 885021138
PLN148 2 908456347
PLN148 2 930959077
PLN148 2 1041934893
PLN148 2 942999660
PLN148 3 908571112
PLN148 2 934307380
PLN148 2 919820886
PLN148 2 904199719
PLN148 2 879641827
PLN149 26 1166741474
PLN149 2 1019726094
PLN149 2 948044567
PLN149 2 935988512
PLN149 2 1001554393
PLN149 2 1004892626
PLN149 2 870794531
PLN149 2 886494923
PLN149 2 1089597455
PLN149 2 891403268
PLN149 3 916201336
PLN15 232742 566506657
PLN150 51 1170654916
PLN150 2 994915609
PLN150 2 1008745383
PLN150 2 850230395
PLN150 2 915695621
PLN150 2 1025227490
PLN150 2 862764790
PLN150 2 884517818
PLN150 2 958486939
PLN150 2 882430803
PLN150 2 805094337
PLN151 35 1180644427
PLN151 2 912116412
PLN151 2 1080442405
PLN151 2 903251998
PLN151 3 846587112
PLN151 2 1034251136
PLN151 2 1041322427
PLN151 2 959575375
PLN151 2 1005137949
PLN151 2 1136683915
PLN151 2 1019386330
PLN152 35 1178309823
PLN152 3 1015418383
PLN152 2 997148082
PLN152 2 1024702898
PLN152 3 1046276430
PLN152 2 960152348
PLN152 2 997566044
PLN152 2 926826996
PLN152 2 970728340
PLN152 2 1076556621
PLN152 2 961846356
PLN153 34 1165044314
PLN153 3 1105984004
PLN153 2 1091311779
PLN153 2 928973494
PLN153 4 994697394
PLN153 2 1128818178
PLN153 2 1018548947
PLN153 2 883277256
PLN153 2 1015247550
PLN153 2 1033440010
PLN153 2 938819340
PLN154 34 1166648442
PLN154 3 859495519
PLN154 2 1034513146
PLN154 2 973973117
PLN154 2 836784321
PLN154 2 990350501
PLN154 2 1034765442
PLN154 2 973886503
PLN154 2 992822994
PLN154 2 897431557
PLN154 2 808457311
PLN155 34 1154235685
PLN155 2 953662853
PLN155 2 1058778957
PLN155 2 930200695
PLN155 3 895052557
PLN155 2 1043031688
PLN155 2 1031876872
PLN155 2 943080858
PLN155 2 1000998827
PLN155 2 1157028134
PLN155 2 1004786053
PLN156 35 1181945520
PLN156 3 985677594
PLN156 2 787615973
PLN156 2 1005487930
PLN156 2 870370402
PLN156 2 954925343
PLN156 2 877145967
PLN156 2 915888348
PLN156 2 951785915
PLN156 2 976596859
PLN156 2 981034558
PLN157 33 1182117489
PLN157 2 853229614
PLN157 2 968208187
PLN157 2 1065368112
PLN157 2 928206292
PLN157 3 960272742
PLN157 4 1031468481
PLN157 29 1161715798
PLN157 18 1164014015
PLN157 86 1098733546
PLN157 12 1140796870
PLN158 16 963201441
PLN158 53 1160691643
PLN158 29 1105078032
PLN158 50 1145575965
PLN158 43 1177757480
PLN158 43 1150824379
PLN158 34 1155874556
PLN158 50 1155922795
PLN158 47 1132536680
PLN158 23 1141693484
PLN158 26 1169836001
PLN159 1 660154351
PLN159 5 177893042
PLN159 1 1999785258
PLN159 1 1545728702
PLN159 1 1499997841
PLN159 1 1493209057
PLN159 1 1187610474
PLN159 1 943684407
PLN159 8 1161825966
PLN159 39 1170204862
PLN159 39 1150468932
PLN16 1149 781282806
PLN160 1 785289892
PLN160 50 1175229069
PLN160 53 1182975790
PLN160 11 787764687
PLN160 1 656850665
PLN160 1 633960920
PLN160 1 609171657
PLN160 2 1143703028
PLN160 2 979242293
PLN160 3 990086045
PLN160 4 1070469512
PLN161 1 752191036
PLN161 30 961812843
PLN161 2 1109448078
PLN161 1 767071137
PLN161 1 671256291
PLN161 1 670741101
PLN161 1 671191297
PLN161 1 771176557
PLN161 1 643128204
PLN161 1 694350238
PLN161 1 641290954
PLN162 2 1138634422
PLN162 2 1174904300
PLN162 1 745638687
PLN162 8 1174732410
PLN162 35 1182932636
PLN162 18 1181205473
PLN162 41 1176106470
PLN162 8 972308232
PLN162 5 998918288
PLN162 4 1175221657
PLN162 19 1182622585
PLN163 1 581969875
PLN163 57 1044582350
PLN163 4 954531898
PLN163 5 1025819629
PLN163 6 984147449
PLN163 5 1137917005
PLN163 5 1007898041
PLN163 6 1070397818
PLN163 5 1111212694
PLN163 6 1089162517
PLN163 3 421610440
PLN164 1 742820188
PLN164 1 956684326
PLN164 1 561974515
PLN164 1 718270646
PLN164 1 682093502
PLN164 1 700447244
PLN164 1 683485999
PLN164 1 723946829
PLN164 1 751391258
PLN164 1 651249186
PLN164 2 1175723351
PLN165 1 722258891
PLN165 2 1136845382
PLN165 44 1170528899
PLN165 54 1049025390
PLN165 68 1088778107
PLN165 73 1119209590
PLN165 22 1127767597
PLN165 46 1093558514
PLN165 68 1114528363
PLN165 41 1064490534
PLN165 10 1140443142
PLN166 1 529961705
PLN166 29 1112900486
PLN166 70 1142119072
PLN166 99 1179912936
PLN166 96 1181404594
PLN166 67 1084884007
PLN166 2 933307241
PLN166 7 1182242757
PLN166 22 1177390369
PLN166 8 1153933128
PLN166 37 1144473388
PLN167 1 696896727
PLN167 49 1180784520
PLN167 55 1171927849
PLN167 47 1114711079
PLN167 13 1109766498
PLN167 8 1107099447
PLN167 16 1149081006
PLN167 29 1127504010
PLN167 13 1018612861
PLN167 16 1052342486
PLN167 5 693259785
PLN168 1 768317091
PLN168 2 1045973173
PLN168 2 1158403266
PLN168 80 1164277484
PLN168 199 1115126474
PLN168 18 1171120860
PLN168 21 1146591206
PLN168 31 1102785788
PLN168 8 1076126098
PLN168 8 864666226
PLN168 3 1111279011
PLN169 1 635914663
PLN169 40 1157082133
PLN169 47 1162966031
PLN169 32 1101235099
PLN169 49 1021545126
PLN169 4 1128758998
PLN169 6 1144601540
PLN169 3 940719410
PLN169 5 1181840911
PLN169 4 1038695499
PLN169 4 1011553213
PLN17 1327 988962589
PLN170 1 873778448
PLN170 102 1156287238
PLN170 31 1179681258
PLN170 42 689746606
PLN170 1 1074544454
PLN170 1 1022901297
PLN170 1 981102465
PLN170 1 976125608
PLN170 1 917323440
PLN170 1 850457102
PLN170 1 839193984
PLN171 1 759363255
PLN171 1 817723161
PLN171 1 817139115
PLN171 1 814406492
PLN171 1 772677518
PLN171 1 772908146
PLN171 1 765793897
PLN171 1 761983751
PLN171 1 764473882
PLN171 4 1011158055
PLN171 4 1008776197
PLN172 1 661150927
PLN172 6 815519305
PLN172 2 991469964
PLN172 2 816205905
PLN172 3 1056510218
PLN172 3 989952844
PLN172 3 956055548
PLN172 3 919956468
PLN172 7 1163446212
PLN172 28 1167164746
PLN172 16 1110397238
PLN173 1 822617018
PLN173 39 1181990064
PLN173 67 1182319274
PLN173 74 1160385311
PLN173 73 1003005145
PLN173 6 1144285054
PLN173 5 693883568
PLN173 2 1069887694
PLN173 2 1168781261
PLN173 16 1182073380
PLN173 45 1176527092
PLN174 1 788135348
PLN174 34 1121126959
PLN174 9 1099497021
PLN174 23 1182637469
PLN174 14 985562895
PLN174 4 1148967398
PLN174 7 1119025184
PLN174 5 1091663592
PLN174 6 1099009318
PLN174 27 1135567827
PLN174 13 1133007134
PLN175 1 505466611
PLN175 15 1135637088
PLN175 41 1163273408
PLN175 22 1080875863
PLN175 22 1103049530
PLN175 1 949323565
PLN175 1 915317115
PLN175 1 901665926
PLN175 1 822089110
PLN175 1 755633405
PLN175 1 854068172
PLN176 1 723777933
PLN176 2 1141141404
PLN176 2 1041566903
PLN176 2 1001403931
PLN176 2 875973322
PLN176 43 1173385605
PLN176 30 1092520979
PLN176 19 1076669045
PLN176 25 1151243202
PLN176 41 1092457164
PLN176 8 1107304518
PLN177 5 1107711193
PLN177 14 1177666894
PLN177 76 1124581439
PLN177 5 1103363314
PLN177 8 1175959732
PLN177 20 1168219198
PLN177 40 1182650958
PLN177 64 1153359822
PLN177 11 801094462
PLN177 2 840426663
PLN177 3 1133062094
PLN178 9 1071213085
PLN178 49 967271682
PLN178 2 1130771350
PLN178 2 1164863489
PLN178 2 1091053465
PLN178 2 1110446937
PLN178 1 650429017
PLN178 1 615497416
PLN178 1 605521199
PLN178 2 1151975812
PLN178 2 1040516887
PLN179 7 1044550543
PLN179 1 638826493
PLN179 1 605724068
PLN179 2 1161881882
PLN179 2 1174936293
PLN179 2 1161162149
PLN179 1 618366599
PLN179 1 606666664
PLN179 2 1134915552
PLN179 2 1149087886
PLN179 1 652904783
PLN18 446 1087262647
PLN180 10 1138720651
PLN180 1 620394872
PLN180 1 604515745
PLN180 2 1143962729
PLN180 2 1109768142
PLN180 1 623097078
PLN180 2 1164411152
PLN180 2 1089609646
PLN180 2 1104012305
PLN180 1 653771317
PLN180 1 619592024
PLN181 7 1023679923
PLN181 1 602189318
PLN181 2 1138238587
PLN181 2 1141977764
PLN181 1 662784976
PLN181 1 616351571
PLN181 1 604894944
PLN181 2 1131415633
PLN181 2 1143337624
PLN181 1 655822004
PLN181 1 616990145
PLN182 8 1058501289
PLN182 1 608259649
PLN182 2 1145732503
PLN182 43 1149278425
PLN182 31 1159664024
PLN182 22 1179063734
PLN182 32 1053349457
PLN182 5 1058925349
PLN182 58 1171284441
PLN182 40 350193506
PLN182 1 1034507165
PLN183 9 1088046914
PLN183 1 739697766
PLN183 1 726504577
PLN183 1 697169871
PLN183 1 657249472
PLN183 4 1183264416
PLN183 59 1158848735
PLN183 2 740850932
PLN183 1 613116700
PLN183 2 1110847379
PLN183 1 588160925
PLN184 8 1113257928
PLN184 2 1151556468
PLN184 2 1144988165
PLN184 2 920960533
PLN184 2 964492557
PLN184 2 1026741635
PLN184 2 924313884
PLN184 2 1063012415
PLN184 2 1039365721
PLN184 2 984082969
PLN184 2 1129535037
PLN185 9 1067049681
PLN185 1 606904469
PLN185 1 704570097
PLN185 2 1075296834
PLN185 2 959428510
PLN185 2 1120194583
PLN185 2 907700912
PLN185 2 932374047
PLN185 1 584039244
PLN185 2 1095368857
PLN185 2 1067733679
PLN186 8 1154254085
PLN186 2 1002164729
PLN186 2 1135772918
PLN186 1 615082505
PLN186 1 702454015
PLN186 42 1112181962
PLN186 20 1150250381
PLN186 23 1154816962
PLN186 60 784986231
PLN186 1 572725250
PLN186 1 685330109
PLN187 411 1145799828
PLN187 1 696943691
PLN187 1 629773018
PLN187 1 636614816
PLN187 1 579256678
PLN187 27 1145464043
PLN187 3 938113679
PLN187 36 1177868785
PLN187 58 1179369301
PLN187 59 1175284921
PLN187 6 750509095
PLN188 66 1177974360
PLN188 1 697452890
PLN188 1 716474979
PLN188 1 639720019
PLN188 1 636017747
PLN188 1 586421619
PLN188 24 1173039665
PLN188 44 1184118523
PLN188 47 1166901193
PLN188 45 1174667444
PLN188 45 1178395115
PLN189 41 1114493415
PLN189 34 1155109077
PLN189 15 1149879199
PLN189 155 1151814264
PLN189 24 1141119428
PLN189 10 1153314664
PLN189 21 1169844120
PLN189 56 1152974604
PLN189 20 1129272135
PLN189 2 1115555839
PLN189 2 1002974161
PLN19 427 1135560877
PLN190 16 1170465788
PLN190 2 901479101
PLN190 4 732491706
PLN190 1 1127959451
PLN190 1 1087409829
PLN190 1 1046485798
PLN190 1 1019676980
PLN190 1 967807955
PLN190 1 838786986
PLN190 1 700411051
PLN190 1 694962670
PLN191 34 1173312785
PLN191 39 1151215141
PLN191 10 970223738
PLN191 21 1179220770
PLN191 43 1182912800
PLN191 43 1173064982
PLN191 34 1130980249
PLN191 27 1153123167
PLN191 27 1139309430
PLN191 17 1130303106
PLN191 7 805123679
PLN192 21 1060362529
PLN192 1 731695907
PLN192 1 498928130
PLN192 1 795014878
PLN192 1 801925238
PLN192 1 670943760
PLN192 1 758945776
PLN192 1 869860623
PLN192 1 637624025
PLN192 1 761967929
PLN192 1 691761276
PLN193 8 1136679996
PLN193 1 533851895
PLN193 1 717241891
PLN193 1 738100095
PLN193 1 582137707
PLN193 1 622921430
PLN193 1 746012979
PLN193 1 505005710
PLN193 1 754782214
PLN193 1 767097325
PLN193 26 1180657162
PLN194 47 1182833436
PLN194 14 1135714116
PLN194 13 1142561392
PLN194 9 846608479
PLN194 3 1099362470
PLN194 3 962277806
PLN194 27 1181954211
PLN194 49 1175902110
PLN194 12 1098936530
PLN194 11 1168768016
PLN194 12 843782802
PLN195 89 1169484791
PLN195 3 996194210
PLN195 4 1162029625
PLN195 5 1135478320
PLN195 8 991361234
PLN195 3 1009806456
PLN195 4 1180940189
PLN195 5 1149349845
PLN195 8 1145450003
PLN195 26 1080482572
PLN195 42 1162023041
PLN196 59 1177693555
PLN196 68 1134148184
PLN196 14 1172237460
PLN196 34 1112243618
PLN196 88 1115455574
PLN196 23 1021218304
PLN196 6 1095595659
PLN196 5 792794259
PLN196 1 651505715
PLN196 1 644174002
PLN196 2 1127667560
PLN197 68 1156833424
PLN197 4 1008863458
PLN197 1 667753205
PLN197 1 647043717
PLN197 1 631554701
PLN197 2 1110586516
PLN197 33619 1108936925
PLN197 152672 772914067
PLN197 157837 528421358
PLN198 46 1180350576
PLN199 45 1177325474
PLN2 215256 731597975
PLN20 114 1118994310
PLN200 46 1179482783
PLN201 46 1177751389
PLN202 63 1158393283
PLN203 82 1168767101
PLN204 36 1147373238
PLN205 70 1145223340
PLN206 101535 949945555
PLN207 499080 424540554
PLN208 296989 647276589
PLN209 265268 500593261
PLN21 114 1149208425
PLN210 10165 1087115901
PLN211 17 1127522877
PLN212 513 1081243566
PLN213 4 638455445
PLN214 1 612216829
PLN215 2 1145038356
PLN216 2 1052833268
PLN217 869 1141292333
PLN218 456840 457872076
PLN219 466091 397288292
PLN22 162 1078695112
PLN220 445896 415388747
PLN221 408076 446035486
PLN222 383987 476758230
PLN223 339996 528603730
PLN224 263560 619295770
PLN225 49312 1033059973
PLN226 4974 1091792912
PLN227 1300 1151955439
PLN228 1 675310294
PLN229 1 628753756
PLN23 10 1072770395
PLN230 1 624247919
PLN231 2 1172266179
PLN232 8558 784305539
PLN233 1 727344967
PLN234 1 946003158
PLN235 1 965754312
PLN236 1 906459801
PLN237 1 876148008
PLN238 1 885153844
PLN239 1 899925126
PLN24 8 1134128946
PLN240 4283 1114988573
PLN241 790 778357973
PLN242 1 541700351
PLN243 1 696809892
PLN244 1 655542733
PLN245 1 648987779
PLN246 1 622068216
PLN247 1 583456046
PLN248 132 1176770373
PLN249 1 675310294
PLN25 78 1117210407
PLN250 1 628753756
PLN251 1 624247919
PLN252 2 1172266179
PLN253 345 729691402
PLN254 1 521073757
PLN255 1 672273650
PLN256 1 634137895
PLN257 1 624121443
PLN258 2 1171800569
PLN259 2 1153005584
PLN26 20 1139906759
PLN260 1 661076038
PLN261 1 626572591
PLN262 1 612852138
PLN263 2 1169525711
PLN264 2 1136827172
PLN265 1 653624577
PLN266 1 616219606
PLN267 1 610044819
PLN268 2 1134152592
PLN269 2 1156707404
PLN27 198 1029168242
PLN270 1 685423969
PLN271 1 640667275
PLN272 1 639123876
PLN273 1 612949391
PLN274 1 577192767
PLN275 2 1141642242
PLN276 1 648922534
PLN277 1 604770208
PLN278 2 1173859433
PLN279 2 1159392798
PLN28 129 1027400970
PLN280 2 1164574848
PLN281 1 615767531
PLN282 1 605571303
PLN283 2 1142007082
PLN284 4 1166534982
PLN285 1 710194481
PLN286 1 661081403
PLN287 1 659460550
PLN288 1 630572514
PLN289 1 598618390
PLN29 230 970536985
PLN290 1 658974642
PLN291 1 559656399
PLN292 1 717517502
PLN293 1 672450454
PLN294 1 665297378
PLN295 1 636785599
PLN296 1 599706080
PLN297 1 675658265
PLN298 1 523168208
PLN299 1 671211297
PLN3 139579 751171144
PLN30 32 1032549426
PLN300 1 630677708
PLN301 1 623428415
PLN302 2 1162824663
PLN303 2 1124081839
PLN304 1 640830439
PLN305 1 597781253
PLN306 2 1170541913
PLN307 2 1151597807
PLN308 1 537457279
PLN309 1 685947972
PLN31 76 928976765
PLN310 1 649921694
PLN311 1 641099225
PLN312 1 611845738
PLN313 1 581041262
PLN314 2 1176958498
PLN315 1 667717957
PLN316 1 631819663
PLN317 1 624692602
PLN318 2 1159089013
PLN319 2 1154165677
PLN32 4 1108823292
PLN320 1 670202054
PLN321 1 631946783
PLN322 1 626743494
PLN323 2 1167772850
PLN324 2 1151941538
PLN325 1 671530377
PLN326 1 631910401
PLN327 1 622474059
PLN328 2 1160377439
PLN329 2 1159528938
PLN33 5 1159558460
PLN330 1 684336246
PLN331 1 636053469
PLN332 1 629969872
PLN333 2 1172688001
PLN334 2 1160045407
PLN335 1 665715246
PLN336 1 624683667
PLN337 1 621078253
PLN338 2 1159864294
PLN339 2 1170185454
PLN34 75 1132167485
PLN340 1 697540743
PLN341 1 655862368
PLN342 1 646765634
PLN343 1 618540729
PLN344 1 587963859
PLN345 455 1147653963
PLN346 31 909553549
PLN347 1 705338699
PLN348 1 493450010
PLN349 1 804285258
PLN35 73 1176935891
PLN350 1 810734643
PLN351 1 673981989
PLN352 1 754496630
PLN353 1 855759449
PLN354 1 614042580
PLN355 1 743847818
PLN356 1 673340788
PLN357 1 515668560
PLN358 1 713320806
PLN359 1 703598484
PLN36 167 1039907946
PLN360 1 570159854
PLN361 1 625793224
PLN362 1 721110502
PLN363 1 459355444
PLN364 1 745201001
PLN365 1 749284433
PLN366 1 643344672
PLN367 1 595297365
PLN368 1 688905267
PLN369 1 491807393
PLN37 8 1067069293
PLN370 1 769338634
PLN371 1 671568023
PLN372 1 635285330
PLN373 1 745618965
PLN374 1 839470345
PLN375 1 646400022
PLN376 1 747589525
PLN377 2 1171764895
PLN378 1 703962928
PLN379 1 702438406
PLN38 106 1131642630
PLN380 2 1178978634
PLN381 2 1173154747
PLN382 1 734536914
PLN383 1 738743901
PLN384 1 636778132
PLN385 1 602900890
PLN386 1 697493198
PLN387 1 490518203
PLN388 1 784661008
PLN389 1 810500911
PLN39 31 1147557767
PLN390 1 655314739
PLN391 1 752710991
PLN392 1 890847171
PLN393 1 621781073
PLN394 1 743084022
PLN395 1 676741658
PLN396 1 509452426
PLN397 1 710124532
PLN398 2 1058788934
PLN399 1 620140791
PLN4 30383 957547964
PLN40 307 1036243037
PLN400 1 716573881
PLN401 1 476726550
PLN402 1 756324664
PLN403 1 977471539
PLN404 2 1144819353
PLN405 1 646234737
PLN406 1 605172934
PLN407 2 1165717241
PLN408 2 1153140076
PLN409 1 590561804
PLN41 481 1074884690
PLN410 2 1176631761
PLN411 1 782694893
PLN412 1 796420183
PLN413 1 650274702
PLN414 1 739889549
PLN415 1 848590828
PLN416 1 610626473
PLN417 1 738023571
PLN418 2 1173882462
PLN419 1 701434008
PLN42 228 1075729921
PLN420 1 690770133
PLN421 1 567265955
PLN422 1 612987783
PLN423 1 704156067
PLN424 1 475327881
PLN425 1 732118298
PLN426 1 733931846
PLN427 1 636796232
PLN428 1 599764323
PLN429 1 691313424
PLN43 416 1181505501
PLN430 1 493357854
PLN431 1 782685093
PLN432 1 786410271
PLN433 1 648139033
PLN434 1 744407562
PLN435 1 835583350
PLN436 1 623221719
PLN437 1 741299132
PLN438 1 669032550
PLN439 1 517040482
PLN44 203 1099630913
PLN440 1 711661679
PLN441 1 708205786
PLN442 2 1156892395
PLN443 2 1178356817
PLN444 1 737453356
PLN445 1 736349413
PLN446 1 639162162
PLN447 1 586755746
PLN448 1 704478343
PLN449 1 492109999
PLN45 361 1062439255
PLN450 1 791475352
PLN451 1 785940626
PLN452 1 661246824
PLN453 1 756990402
PLN454 1 858776195
PLN455 1 621195942
PLN456 1 754256086
PLN457 1 670301833
PLN458 1 509263899
PLN459 1 708234589
PLN46 69 1113727739
PLN460 1 725120110
PLN461 1 575129590
PLN462 1 620883766
PLN463 1 727285804
PLN464 1 479660269
PLN465 1 745978486
PLN466 1 750160716
PLN467 1 642428577
PLN468 1 591313643
PLN469 1 705330581
PLN47 512 1105465963
PLN470 1 495656580
PLN471 1 803232604
PLN472 1 790745243
PLN473 1 657494025
PLN474 1 759305888
PLN475 1 856542542
PLN476 1 628321883
PLN477 1 754364263
PLN478 1 697113365
PLN479 1 504254270
PLN48 113 1096204242
PLN480 1 715354979
PLN481 1 713929667
PLN482 1 572943128
PLN483 1 626959190
PLN484 1 715714221
PLN485 1 483823121
PLN486 1 742917797
PLN487 1 748536659
PLN488 1 643784981
PLN489 1 600654286
PLN49 129 1168448427
PLN490 2 1171400808
PLN491 1 794150360
PLN492 1 799857935
PLN493 1 655329108
PLN494 1 749763888
PLN495 1 838116175
PLN496 1 610468321
PLN497 1 736551279
PLN498 2 1171154657
PLN499 2 1170482349
PLN5 4402 1036283513
PLN50 134 1078349221
PLN500 1 566465558
PLN501 1 614421429
PLN502 2 1179310235
PLN503 1 735408736
PLN504 1 969998116
PLN505 11 635028102
PLN506 1 595339094
PLN507 1 698605642
PLN508 1 499102108
PLN509 1 791748890
PLN51 10 1143082295
PLN510 1 797311483
PLN511 1 656817438
PLN512 1 753360318
PLN513 1 845838138
PLN514 1 619661694
PLN515 1 752772853
PLN516 1 689709469
PLN517 1 509595892
PLN518 1 712797596
PLN519 1 710493282
PLN52 10 1177778079
PLN520 1 570643040
PLN521 1 619886155
PLN522 1 705533140
PLN523 1 484551304
PLN524 1 740148362
PLN525 1 757233630
PLN526 1 642499559
PLN527 1 594006513
PLN528 1 693261537
PLN529 1 492948387
PLN53 9 1100020254
PLN530 1 781462734
PLN531 1 802944975
PLN532 1 650275864
PLN533 1 756841830
PLN534 1 850623622
PLN535 1 614136911
PLN536 1 723255126
PLN537 2 1177410070
PLN538 1 712168462
PLN539 1 712339524
PLN54 9 1099100303
PLN540 1 564869106
PLN541 1 619418949
PLN542 1 715454519
PLN543 1 478264344
PLN544 1 734693445
PLN545 1 749685439
PLN546 1 633598967
PLN547 1 782818162
PLN548 1 1022071454
PLN549 1 971920087
PLN55 6 999973243
PLN550 1 827198496
PLN551 1 867619200
PLN552 1 806566123
PLN553 1 1015700474
PLN554 1 742303966
PLN555 1 956173857
PLN556 1 916702776
PLN557 1 874517040
PLN558 1 816294110
PLN559 1 750216944
PLN56 37 1183960544
PLN560 196 1003376355
PLN561 2 1182091663
PLN562 1 621516506
PLN563 1 610333535
PLN564 2 1150013201
PLN565 120 946417647
PLN566 5 1140594043
PLN567 773 1136041142
PLN568 18 958385885
PLN569 3 1008669690
PLN57 237 1046857349
PLN570 27314 1072986454
PLN571 2028 954547119
PLN572 1 594102056
PLN573 1 689851870
PLN574 1 495453186
PLN575 1 780798557
PLN576 1 801256715
PLN577 1 651852609
PLN578 1 750843639
PLN579 1 830829764
PLN58 97 1069375479
PLN580 1 615552423
PLN581 1 744588157
PLN582 1 673617499
PLN583 1 509857067
PLN584 1 709773743
PLN585 1 713149757
PLN586 1 566080677
PLN587 1 618079260
PLN588 1 720988478
PLN589 1 473592718
PLN59 12 1141850928
PLN590 1 736706236
PLN591 1 750620385
PLN592 2571 1146358435
PLN593 19714 976433542
PLN594 1 585266722
PLN595 1 681112512
PLN596 1 775448786
PLN597 1 790338525
PLN598 1 746673839
PLN599 1 836514780
PLN6 84 1095629617
PLN60 5 1125968574
PLN600 1 736872137
PLN601 1 676292951
PLN602 1 669155517
PLN603 1 701372996
PLN604 1 615672275
PLN605 1 698614761
PLN606 1 728031845
PLN607 134546 917931176
PLN608 273407 596362746
PLN609 305654 565680031
PLN61 217 1058580073
PLN610 244223 638889383
PLN611 208908 670843655
PLN612 167982 730295591
PLN613 173995 724551798
PLN614 153529 757219547
PLN615 173729 723218705
PLN616 164112 741027652
PLN617 119720 801501370
PLN618 197750 716643824
PLN619 155855 756231798
PLN62 122 1121076558
PLN620 102202 858615716
PLN621 6 777226842
PLN622 1 678170541
PLN623 1 639558213
PLN624 1 629672760
PLN625 2 1174163216
PLN626 2 1166970321
PLN627 1 684376481
PLN628 1 642597466
PLN629 1 631979072
PLN63 33 1173499004
PLN630 1 607115911
PLN631 1 582960187
PLN632 1 640026769
PLN633 1 608979116
PLN634 1 720972993
PLN635 1 501257520
PLN636 1 804602427
PLN637 1 808121247
PLN638 1 649118519
PLN639 1 758906661
PLN64 7 1073459515
PLN640 1 861141126
PLN641 1 642382296
PLN642 1 759893476
PLN643 1 689766370
PLN644 1 531462149
PLN645 1 714517032
PLN646 1 717288350
PLN647 1 586345039
PLN648 1 626266972
PLN649 1 738085275
PLN65 4 997103331
PLN650 1 505809789
PLN651 1 759124079
PLN652 1 751612808
PLN653 12 1160338339
PLN654 685 1037884752
PLN655 2 1145861525
PLN656 2 1112884977
PLN657 2 941790226
PLN658 2 872653306
PLN659 2 944711370
PLN66 4 1034364549
PLN660 2 896921305
PLN661 2 995026189
PLN662 2 869378871
PLN663 2 922541915
PLN664 2 917029648
PLN665 2 1113527553
PLN666 1 667652801
PLN667 2 1153333809
PLN668 2 976557482
PLN669 2 971318115
PLN67 27 1154324436
PLN670 2 905021021
PLN671 2 779060037
PLN672 2 1026993414
PLN673 2 1040398764
PLN674 2 906287378
PLN675 2 1107801300
PLN676 2 1085890887
PLN677 2 1048094875
PLN678 2 1011185181
PLN679 2 1092181461
PLN68 258 1109049719
PLN680 2 1026383973
PLN681 2 1018992133
PLN682 21 1150858229
PLN683 1 794474755
PLN684 1 760111594
PLN685 1 769810128
PLN686 1 715684684
PLN687 1 623890083
PLN688 1 755457679
PLN689 1 717109572
PLN69 16 833901486
PLN690 1 817712742
PLN691 1 864624966
PLN692 1 701857263
PLN693 1 726425509
PLN694 1 738041677
PLN695 1 767912069
PLN696 2 1167186906
PLN697 2 1167934623
PLN698 2 1091547167
PLN699 3 1082389428
PLN7 175 1160007531
PLN70 2 1182090258
PLN700 4 1174948639
PLN701 3 1022191755
PLN702 320 1104176749
PLN703 142 1040534860
PLN704 403 1143989685
PLN705 25 965865578
PLN706 2 1083817966
PLN707 2 1135086767
PLN708 2 1031765593
PLN709 149 1154467731
PLN71 2 1171115910
PLN710 31 1157770692
PLN711 1045 845678948
PLN712 1 703076930
PLN713 1 495911329
PLN714 1 796169439
PLN715 1 779372321
PLN716 1 665561653
PLN717 1 757165295
PLN718 1 852704148
PLN719 1 623698249
PLN72 2 1040680739
PLN720 1 745048881
PLN721 1 677947850
PLN722 1 524289323
PLN723 1 726838826
PLN724 1 701430346
PLN725 1 584133940
PLN726 1 622677745
PLN727 1 745712656
PLN728 1 490622797
PLN729 1 748850018
PLN73 46 1128549117
PLN730 1 753856519
PLN731 700 674126380
PLN732 1 593930347
PLN733 1 702775664
PLN734 1 494594617
PLN735 1 792837209
PLN736 1 812232696
PLN737 1 661835603
PLN738 1 750337041
PLN739 1 854463248
PLN74 45 1173269211
PLN740 1 623248023
PLN741 1 749950614
PLN742 1 673746810
PLN743 1 520815567
PLN744 1 712547961
PLN745 1 703299309
PLN746 1 569771178
PLN747 1 620176429
PLN748 1 717542863
PLN749 1 493761083
PLN75 39 1169981209
PLN750 1 746502734
PLN751 1 752612656
PLN752 573 686952725
PLN753 2 990024350
PLN754 2 888868060
PLN755 2 933784370
PLN756 2 956308001
PLN757 1 589118817
PLN758 1 638425132
PLN759 1 716105986
PLN76 55 1130689221
PLN760 1 613160974
PLN761 2 1177939381
PLN762 2 1016319037
PLN763 2 936303591
PLN764 2 797242864
PLN765 242 1168816031
PLN766 442 902950534
PLN767 1 593930347
PLN768 1 702775664
PLN769 1 494594617
PLN77 85 1176014133
PLN770 1 792837209
PLN771 1 812232696
PLN772 1 661835603
PLN773 1 750337041
PLN774 1 854463248
PLN775 1 623248023
PLN776 1 749950614
PLN777 1 673746810
PLN778 1 520815567
PLN779 1 712547961
PLN78 51 1140606306
PLN780 1 703299309
PLN781 1 569771178
PLN782 1 620176429
PLN783 1 717542863
PLN784 1 493761083
PLN785 1 746502734
PLN786 1 752612656
PLN787 233 1180834457
PLN788 6503 509584943
PLN789 1 657893865
PLN79 72 1053969040
PLN790 2 1156686622
PLN791 2 1150914040
PLN792 380 1155145851
PLN793 59 1166081052
PLN794 42 1159685336
PLN795 64 1170728010
PLN796 42 1168248595
PLN797 43 1182686463
PLN798 34 1160973286
PLN799 40 1141073775
PLN8 11 1122979570
PLN80 22 1179896937
PLN800 22 1158196445
PLN801 39 1163413684
PLN802 1539 1070673887
PLN803 29 1141110474
PLN804 102 1109427475
PLN805 18 1136907998
PLN806 18 1120554374
PLN807 417 1029040564
PLN808 4 1080552710
PLN809 37 1137925102
PLN81 66 1183477054
PLN810 16 1169275918
PLN811 136 1137571571
PLN812 17 1105635108
PLN813 24 1171571936
PLN814 189 1083652115
PLN815 1 709345803
PLN816 1 499575344
PLN817 1 795989443
PLN818 1 809120074
PLN819 1 670531570
PLN82 104 1075874704
PLN820 1 759055895
PLN821 1 872909281
PLN822 1 637083831
PLN823 1 765902670
PLN824 1 688536368
PLN825 1 533804092
PLN826 1 714878730
PLN827 1 728610199
PLN828 1 586077705
PLN829 1 622419581
PLN83 44 1182176967
PLN830 1 733835468
PLN831 1 506756789
PLN832 1 759450946
PLN833 1 768174826
PLN834 3 659068422
PLN835 1 865431811
PLN836 1 841368522
PLN837 1 772393794
PLN838 1 766078222
PLN839 1 735900830
PLN84 16 1128509064
PLN840 1 693266847
PLN841 1 690056233
PLN842 1 654671025
PLN843 1 681539918
PLN844 1 650134427
PLN845 1 643737533
PLN846 2 1092839925
PLN847 2 1066926645
PLN848 2 971611548
PLN849 13 427663120
PLN85 16 1128356139
PLN850 1 1574527093
PLN851 1 1805244829
PLN852 1 1716769615
PLN853 1 1637815978
PLN854 1 1645877737
PLN855 1 1365994436
PLN856 1 1520236431
PLN857 21 825294730
PLN858 1 660114068
PLN859 1 623862790
PLN86 16 1133014162
PLN860 1 606413785
PLN861 2 1155915948
PLN862 2 1148187217
PLN863 1 662966845
PLN864 1 626943711
PLN865 1 613583204
PLN866 2 1152592070
PLN867 2 1147808788
PLN868 1 656479363
PLN869 1 621609376
PLN87 16 1138262929
PLN870 1 611088072
PLN871 2 1140013277
PLN872 2 1154214120
PLN873 1 661498744
PLN874 1 626053568
PLN875 1 608346219
PLN876 2 1151823422
PLN877 2 1162621306
PLN878 1 661546608
PLN879 1 633922074
PLN88 16 1135203198
PLN880 1 612932250
PLN881 2 1146351859
PLN882 2 1158675416
PLN883 1 664715623
PLN884 1 631770265
PLN885 1 613234972
PLN886 1 604325310
PLN887 1 582152544
PLN888 2 1158575799
PLN889 1 661621317
PLN89 16 1143774097
PLN890 1 626868012
PLN891 1 607094319
PLN892 2 1149874108
PLN893 2 1149787837
PLN894 1 656602423
PLN895 1 622110859
PLN896 1 612883152
PLN897 2 1142529769
PLN898 2 1154234909
PLN899 1 656789389
PLN9 4 948160392
PLN90 16 1155049463
PLN900 1 625372561
PLN901 1 603451504
PLN902 2 1159731212
PLN903 2 1150269419
PLN904 1 657552530
PLN905 1 618447767
PLN906 1 613586716
PLN907 2 1143934454
PLN908 2 1152640102
PLN909 1 676241010
PLN91 16 1156136370
PLN910 1 632313166
PLN911 1 603807353
PLN912 2 1155326502
PLN913 2 1150412865
PLN914 1 662000247
PLN915 1 633487160
PLN916 1 612164168
PLN917 2 1159122729
PLN918 2 1150238410
PLN919 1 660449817
PLN92 70 730992169
PLN920 1 627269420
PLN921 1 602651360
PLN922 2 1162506895
PLN923 2 1158496591
PLN924 1 664401522
PLN925 1 626503588
PLN926 1 611188438
PLN927 2 1171231026
PLN928 2 1156345588
PLN929 1 657436430
PLN93 2 1140624142
PLN930 1 621715108
PLN931 1 610707416
PLN932 2 1147845639
PLN933 2 1151723189
PLN934 1 660500976
PLN935 1 634743673
PLN936 1 616002081
PLN937 2 1150169128
PLN938 2 1153490048
PLN939 1 669356984
PLN94 1 587623253
PLN940 1 631173187
PLN941 1 607766370
PLN942 2 1145806163
PLN943 2 1143277701
PLN944 1 664077638
PLN945 1 624178744
PLN946 1 609451706
PLN947 2 1144639091
PLN948 1 631526965
PLN949 1 660034972
PLN95 1 663525381
PLN950 1 625104971
PLN951 1 608830648
PLN952 2 1146797356
PLN953 2 1146984767
PLN954 1 526310788
PLN955 1 664689228
PLN956 1 632403820
PLN957 1 613638454
PLN958 2 1172960765
PLN959 2 1147017396
PLN96 2 1170194602
PLN960 1 660476038
PLN961 1 624334204
PLN962 1 613769411
PLN963 2 1147499918
PLN964 2 1148490360
PLN965 1 663019822
PLN966 1 626669531
PLN967 1 612901747
PLN968 2 1150057662
PLN969 2 1157797487
PLN97 52 1140868282
PLN970 1 667210568
PLN971 1 635382001
PLN972 1 614569426
PLN973 2 1169192410
PLN974 2 1163716432
PLN975 1 626973123
PLN976 1 611284754
PLN977 2 1150481064
PLN978 1 659290088
PLN979 2 1150737255
PLN98 53 1137938586
PLN980 1 660553991
PLN981 1 632999331
PLN982 1 616334843
PLN983 2 1174596045
PLN984 2 1159220941
PLN985 1 659217363
PLN986 1 627225202
PLN987 1 611858135
PLN988 2 1164391514
PLN989 2 1152376894
PLN99 23 1161219862
PLN990 1 660591081
PLN991 1 627080904
PLN992 1 609113147
PLN993 2 1138662036
PLN994 2 1154130688
PLN995 1 659787933
PLN996 1 626680366
PLN997 1 612118009
PLN998 2 1146809099
PLN999 2 1153763781
PRI1 51161 1002824769
PRI10 13 1100500214
PRI100 15 1181012644
PRI101 13 1040825256
PRI102 9 1070180120
PRI103 120 1141288485
PRI104 12 1138941381
PRI105 21 1179091292
PRI106 13 1107729811
PRI107 11 1140716802
PRI108 175 1113439382
PRI109 17 1146053835
PRI11 7 1032781085
PRI110 16 1112303007
PRI111 89 1149798270
PRI112 14 1095631751
PRI113 14 1109144986
PRI114 287 1130768822
PRI115 9 1109550286
PRI116 50 1056773376
PRI117 11 1058599569
PRI118 12 1147175924
PRI119 129 1045453423
PRI12 5 1067810412
PRI120 14 1045565768
PRI121 15 1112017113
PRI122 78 1007102649
PRI123 11 1122198877
PRI124 16 1180382249
PRI125 113 1148762732
PRI126 13 1108403327
PRI127 26 1141760953
PRI128 13 1092694835
PRI129 14 1140995957
PRI13 9 1180671468
PRI130 319 1020829798
PRI131 18 1131592109
PRI132 10 1101606557
PRI133 28 1007822526
PRI134 12 1135296282
PRI135 14 1158573682
PRI136 31 1042760633
PRI137 21 1149879308
PRI138 73 1157793061
PRI139 17 1073496211
PRI14 8 1107000153
PRI140 19 1184147845
PRI141 367 1164747047
PRI142 11 995319435
PRI143 15 1180327720
PRI144 73 978026046
PRI145 14 980737478
PRI146 15 1167618994
PRI147 151 1130654396
PRI148 10 1178420820
PRI149 46 1165457402
PRI15 11 1174619811
PRI150 16 1138886962
PRI151 18 1150234449
PRI152 326 1139459030
PRI153 11 1105326025
PRI154 18 1061935040
PRI155 27 1084071148
PRI156 13 1132102457
PRI157 75 1176492073
PRI158 18 1128354402
PRI159 14 1172029366
PRI16 6 1064076226
PRI160 27 1121725746
PRI161 13 1014482922
PRI162 9 1081708515
PRI163 294 1181073471
PRI164 92 1144808360
PRI165 24 1059032867
PRI166 17 1095246750
PRI167 264 1160885053
PRI168 63 1069216739
PRI169 13 1061440347
PRI17 11 1177365167
PRI170 16 1154534859
PRI171 74 1130528088
PRI172 12 1052421338
PRI173 14 1157378407
PRI174 240 1142043667
PRI175 353 1092575962
PRI176 17 1151712823
PRI177 20 1150571825
PRI178 10 1077063477
PRI179 24 1106755904
PRI18 11 1103395128
PRI180 13 1064310573
PRI181 17 1123386703
PRI182 57 1172654739
PRI183 16 1165794253
PRI184 569 1102965079
PRI185 18 1182712802
PRI186 52 1095510295
PRI187 10 1118000252
PRI188 168 1146745968
PRI189 9 1110809597
PRI19 8 1081303381
PRI190 43 1017369865
PRI191 21 985643222
PRI192 320 1077277149
PRI193 99 1167993912
PRI194 15 1078999347
PRI195 178 1175521079
PRI196 16 1117724155
PRI197 9 1092641025
PRI198 133 1132456182
PRI199 11 1090965131
PRI2 7910 1072145329
PRI20 6 1136611601
PRI200 11 1136520153
PRI201 25 1109223510
PRI202 31 1170866006
PRI203 22 1089981244
PRI204 11 1160827036
PRI205 97 1174530068
PRI206 357 1132322130
PRI207 16 1149860906
PRI208 19 1108664381
PRI209 270 1167059546
PRI21 225210 749803779
PRI210 8 960754211
PRI211 17 1142089276
PRI212 113 1123613306
PRI213 11 1179737992
PRI214 10 1154243139
PRI215 117 1174221652
PRI216 13 1063356666
PRI217 296 1133458643
PRI218 14 1161335653
PRI219 11 1114428479
PRI22 177390 651438117
PRI220 247 1172005160
PRI221 11 1062830725
PRI222 163 1059056445
PRI223 9 1102388911
PRI224 8 1105952181
PRI225 25 1058189466
PRI226 11 1135739344
PRI227 10 1046394222
PRI228 53 1067234263
PRI229 10 1147368977
PRI23 110397 845176190
PRI230 363 1165083272
PRI231 12 1077163217
PRI232 11 1162634480
PRI233 23 1161865142
PRI234 12 1126515186
PRI235 12 1163211790
PRI236 476 1131507684
PRI237 10 1120271414
PRI238 15 1154374540
PRI239 317 1011640206
PRI24 160080 708018652
PRI240 14 1151842759
PRI241 30 1092825541
PRI242 16 1082447657
PRI243 14 1158135268
PRI244 899 1183467936
PRI245 19 1122161472
PRI246 20 1183066230
PRI247 75 1153125911
PRI248 20 1161072802
PRI249 504 1131568942
PRI25 79508 975061211
PRI250 19 1168418729
PRI251 17 1087040239
PRI252 148 1105519326
PRI253 14 1164645498
PRI254 21 1181530736
PRI255 346 1159179407
PRI256 19 1163796128
PRI257 160 1102067593
PRI258 11 1063084062
PRI259 19 1064156912
PRI26 739 1177886289
PRI260 450 1025005459
PRI261 22 1126793321
PRI262 17 1179466154
PRI263 42 1161140959
PRI264 24 1120832764
PRI265 11 1155993068
PRI266 99 1145156564
PRI267 9 1102724860
PRI268 91 1183427497
PRI269 19 1154211600
PRI27 1225 1108508917
PRI270 9 1150032117
PRI271 222 1123372778
PRI272 13 1053726974
PRI273 8 1166119572
PRI274 109 1106272201
PRI275 11 1061690594
PRI276 23 1053944764
PRI277 10 1100191309
PRI278 9 1178425990
PRI279 14 1100560332
PRI28 13 1137980641
PRI280 15 1031336361
PRI281 8 1152223354
PRI282 165 1012912191
PRI283 12 1101224225
PRI284 15 1115849849
PRI285 89 1114474603
PRI286 8 1151170256
PRI287 65 1143039387
PRI288 15 1118101622
PRI289 13 1069221035
PRI29 11 1089653569
PRI290 142 1054214909
PRI291 9 1166723153
PRI292 18 1140507064
PRI293 72 963212938
PRI294 14 1148339428
PRI295 39 1041061246
PRI296 11 1095067328
PRI297 11 1094431541
PRI298 142 1014774443
PRI299 11 1090793443
PRI3 7901 1132972500
PRI30 238 1117857898
PRI300 9 1038388354
PRI301 98 1061078202
PRI302 10 1168112973
PRI303 12 1103167620
PRI304 269 1089423682
PRI305 16 1067149770
PRI306 51 1096741393
PRI307 14 1148619844
PRI308 16 1171061459
PRI309 293 1173859690
PRI31 18 1144634850
PRI310 14 1170966762
PRI311 16 1134764047
PRI312 29 1144492265
PRI313 9 1063878272
PRI314 162 1148544359
PRI315 11 1121324836
PRI316 9 1024863486
PRI317 98 1123634864
PRI318 13 1142109257
PRI319 16 1091383016
PRI32 15 1177028791
PRI320 338 1054776526
PRI321 25 1156859424
PRI322 42 1172162490
PRI323 20 1139949990
PRI324 18 1148357791
PRI325 270 1160151966
PRI326 9 1145469135
PRI327 12 1101301543
PRI328 46 1110431448
PRI329 14 1071322935
PRI33 19 1157503881
PRI330 141 1127225925
PRI331 13 1143046837
PRI332 11 1056487704
PRI333 57 1108247906
PRI334 8 1128609065
PRI335 12 985516952
PRI336 55 1107201184
PRI337 13 1122919431
PRI338 14 1146457938
PRI339 87 1030817204
PRI34 12 1136831832
PRI340 15 1183981661
PRI341 274 1177269657
PRI342 14 1129282143
PRI343 11 1153362077
PRI344 18 1157111224
PRI345 13 1182441061
PRI346 107 1108532920
PRI347 15 1145180719
PRI348 44 1099215470
PRI349 15 1130554745
PRI35 197 1025575505
PRI350 11 1053316046
PRI351 259 1127981555
PRI352 129 1123965493
PRI353 7 1093000977
PRI354 14 1087046044
PRI355 28 1038723961
PRI356 15 1023867813
PRI357 118 1085779101
PRI358 10 1183494445
PRI359 16 1055723815
PRI36 12 1138019906
PRI360 43 1095487107
PRI361 12 1142362092
PRI362 10 1127530151
PRI363 242 1070861830
PRI364 9 1145381908
PRI365 13 1053727156
PRI366 48 950507027
PRI367 8 980986954
PRI368 14 1127513488
PRI369 169 1038664996
PRI37 14 1138707002
PRI370 17 1170616704
PRI371 57 1165646147
PRI372 11 1052178143
PRI373 13 1064501084
PRI374 732 1039299363
PRI375 18 1161964578
PRI376 8 1065684687
PRI377 35 1144185055
PRI378 18 1169266590
PRI379 11 1146467318
PRI38 22 1147922733
PRI380 520 1130532285
PRI381 24 1109904261
PRI382 241 1128821518
PRI383 22 1172993976
PRI384 42 1169489004
PRI385 374 1179142470
PRI386 25 1171283457
PRI387 95 1182694674
PRI388 387 1051668593
PRI389 28 1178144342
PRI39 47 1183977449
PRI390 297 1061561299
PRI391 14 1085218529
PRI392 29 1176194437
PRI393 262 1134778600
PRI394 28 1172380884
PRI395 164 1172827096
PRI396 50 1178545833
PRI397 106 1170115500
PRI398 409 1135976160
PRI399 39 1170267735
PRI4 10360 1160614863
PRI40 188 1133631545
PRI400 88 1183543404
PRI401 419 1138396166
PRI402 20 1104618136
PRI403 290 1160228177
PRI404 20 1140254199
PRI405 29 1146876900
PRI406 593 1183236336
PRI407 83 1175880761
PRI408 194 1183366334
PRI409 267 1103620965
PRI41 14 1142991141
PRI410 88 1171815606
PRI411 645 1154675985
PRI412 31 1154431127
PRI413 76 1178147875
PRI414 423 1122531646
PRI415 29 1172448949
PRI416 355 1141845987
PRI417 14 1144954889
PRI418 27 1179386709
PRI419 259 1105338696
PRI42 40 1160458361
PRI420 19 1133950218
PRI421 54 1180118078
PRI422 529 1166706593
PRI423 31 1175912639
PRI424 240 1145065826
PRI425 21 1180894405
PRI426 47 1179227752
PRI427 324 1182866248
PRI428 241 1177607280
PRI429 58 1182337510
PRI43 20 1057613772
PRI430 402 1152830512
PRI431 44 1151634948
PRI432 37 1143620230
PRI433 16 1088880759
PRI434 29 1172575319
PRI435 319 1128405637
PRI436 19 1122111145
PRI437 237 1167529979
PRI438 22 1166218701
PRI439 35 1180090100
PRI44 200 1140863931
PRI440 338 1164714195
PRI441 21 1180589910
PRI442 335 1183831259
PRI443 217 1147408674
PRI444 30 1144456804
PRI445 449 1137912908
PRI446 25 1152222839
PRI447 67 1184077943
PRI448 97 1122866973
PRI449 18 1175183648
PRI45 11 1151193512
PRI450 270 1078319496
PRI451 18 1176136734
PRI452 34 1128529128
PRI453 336 1179599436
PRI454 26 1152198720
PRI455 100 1184022181
PRI456 223 1167431580
PRI457 19 1091959869
PRI458 192 1176329468
PRI459 316 1169332729
PRI46 14 1181280751
PRI460 49 1174191359
PRI461 151 1119576440
PRI462 34 1160083819
PRI463 240 1164766365
PRI464 22 1171522146
PRI465 37 1182812516
PRI466 423 1169577328
PRI467 50 1148816672
PRI468 557 1183750783
PRI469 307 1160761335
PRI47 54 1173482317
PRI470 43 1176325681
PRI471 489 1174210476
PRI472 23 1177973310
PRI473 63 1183861711
PRI474 160 1099347348
PRI475 22 1182587292
PRI476 380 1110685127
PRI477 21 1180196129
PRI478 35 1156225239
PRI479 577 1175380290
PRI48 607 1183152867
PRI480 29 1147606532
PRI481 333 1160165881
PRI482 21 1173091154
PRI483 22 1156431823
PRI484 276 1083400079
PRI485 14 1026150293
PRI486 28 1183275310
PRI487 386 1111964003
PRI488 17 1125549417
PRI489 128 1135628917
PRI49 31 1167460459
PRI490 14 1091125214
PRI491 30 1156269024
PRI492 307 1161203999
PRI493 20 1139087515
PRI494 47 1182040418
PRI495 602 1164413197
PRI496 41 1167807540
PRI497 331 1148540042
PRI498 27 1155946803
PRI499 33 1173630125
PRI5 152425 840442381
PRI50 15 968255797
PRI500 402 1162958913
PRI501 25 1151582193
PRI502 86 1179818100
PRI503 369 1148376489
PRI504 23 1135238555
PRI505 226 1114879275
PRI506 24 1155260752
PRI507 36 1182993398
PRI508 289 1164436387
PRI509 30 1162980653
PRI51 141 1113642329
PRI510 222 1093874982
PRI511 17 1122547959
PRI512 29 1169235295
PRI513 387 1167088006
PRI514 18 1167884431
PRI515 62 1182749845
PRI516 246 1170557969
PRI517 38 1179859497
PRI518 335 1129497602
PRI519 21 1148579718
PRI52 11 1083973634
PRI520 60 1172507724
PRI521 249 1129111945
PRI522 27 1148917466
PRI523 440 1117703618
PRI524 23 1069132309
PRI525 43 1158135491
PRI526 348 1178821458
PRI527 31 1134311829
PRI528 161 1183805148
PRI529 301 1175334531
PRI53 16 954414851
PRI530 45 1172026447
PRI531 895 1147028264
PRI532 21 1184058029
PRI533 52 1169336829
PRI534 442 1147978791
PRI535 22 1144344431
PRI536 86 1180086042
PRI537 440 1162607155
PRI538 68 1173607909
PRI539 163 1182127574
PRI54 39 1178434910
PRI540 321 1166963360
PRI541 53 1177585670
PRI542 26 1148998822
PRI543 25 1148988166
PRI544 530 1173372077
PRI545 18 1137883702
PRI546 42 1170954641
PRI547 370 1137716293
PRI548 26 1108303806
PRI549 78 1180760906
PRI55 9 1103067380
PRI550 546 1139436696
PRI551 36 1151138005
PRI552 428 1153216606
PRI553 27 1149572242
PRI554 61 1181303924
PRI555 347 1134301180
PRI556 44 1172407846
PRI557 668 1146926824
PRI558 24 1164039393
PRI559 35 1152698423
PRI56 13 1114260520
PRI560 225 1050138502
PRI561 17 1116953631
PRI562 47 1161829558
PRI563 263 1131175559
PRI564 17 1167045095
PRI565 130 1170440659
PRI566 23 1170751301
PRI567 45 1168756544
PRI568 336 1077579028
PRI569 31 1171579240
PRI57 202 1058075412
PRI570 46 1165866303
PRI571 185 1169751544
PRI572 36 1160535067
PRI573 67 1085475194
PRI574 16 1175457768
PRI575 21 1175531784
PRI576 150 1179225597
PRI577 29 1173723084
PRI578 189 1134761868
PRI579 16 1139339206
PRI58 12 1137771012
PRI580 21 1153090874
PRI581 220 1149289905
PRI582 15 1183230533
PRI583 51 1183409088
PRI584 199 1182752069
PRI585 18 1045474622
PRI586 171 1059343895
PRI587 16 1172600038
PRI588 40 1158674954
PRI589 203 1164715697
PRI59 13 1168936209
PRI590 140 1142928696
PRI591 20 1131763145
PRI592 137 1148815782
PRI593 15 1100704625
PRI594 26 1127650628
PRI595 14 1150133421
PRI596 28 1166922896
PRI597 160 1129537305
PRI598 16 1117749341
PRI599 52 1176068226
PRI6 19989 1008567045
PRI60 29 1119598237
PRI600 217 1179197902
PRI601 29 1151336253
PRI602 173 1166863352
PRI603 20 1119185302
PRI604 41 1182586466
PRI605 303 1108937327
PRI606 17 1178542928
PRI607 89 1181878085
PRI608 198 1168056922
PRI609 37 1162632930
PRI61 13 1136681750
PRI610 82 1090767801
PRI611 16 1118484017
PRI612 38 1180674386
PRI613 197 1124462681
PRI614 22 1166614165
PRI615 197 1156201482
PRI616 13 1183357777
PRI617 31 1176936859
PRI618 211 1177301751
PRI619 23 1157099048
PRI62 72 1150950945
PRI620 89 1181629503
PRI621 141 1145455058
PRI622 21 1134683646
PRI623 203 1136922984
PRI624 26 1128803731
PRI625 47 1164969225
PRI626 216 1144273751
PRI627 27 1147212275
PRI628 245 1183082543
PRI629 150 1178032495
PRI63 8 1069277973
PRI630 63 1170025397
PRI631 394 1158613244
PRI632 51 1179270913
PRI633 213 1182001532
PRI634 236 1178712747
PRI635 105 1167396875
PRI636 295 1037508240
PRI637 49 1144253249
PRI638 87 1181792319
PRI639 111 1163791102
PRI64 14 1182870917
PRI640 51 1177181081
PRI641 281 1181322695
PRI642 207 1162030194
PRI643 84 1178030256
PRI644 327 1180516469
PRI645 106 1165371512
PRI646 203 1181400504
PRI647 194 1171186638
PRI648 102 1091623059
PRI649 61 1164043386
PRI65 276 1108950718
PRI650 64 1145917483
PRI651 258 1181958699
PRI652 428 1148473811
PRI653 31 1161024218
PRI654 312 1183814897
PRI655 251 1164201158
PRI656 50 1181207252
PRI657 404 1140670929
PRI658 64 1168296557
PRI659 179 1183657962
PRI66 18 1133613294
PRI660 305 1178937361
PRI661 77 1184032239
PRI662 534 1181954998
PRI663 446 1114064345
PRI664 54 1175815478
PRI665 422 1168928105
PRI666 52 1137859327
PRI667 203 1181815950
PRI668 56 1168842034
PRI669 103 1173394187
PRI67 30 1183791123
PRI670 328 1180716257
PRI671 89 1177817236
PRI672 208 1181521116
PRI673 120 1114992882
PRI674 38 1182996135
PRI675 353 1128563635
PRI676 28 1155358462
PRI677 97 1183744343
PRI678 77964 504628550
PRI68 396 1094012951
PRI69 9 1022060953
PRI7 6 1137401032
PRI70 318 1135144509
PRI71 17 1129061517
PRI72 11 1183170586
PRI73 170 1175242492
PRI74 19 1079921441
PRI75 20 1107184059
PRI76 319 1091478744
PRI77 16 1173300867
PRI78 111 1113574380
PRI79 9 1067860042
PRI8 10 1163372937
PRI80 18 1120312625
PRI81 134 1151339059
PRI82 9 1019371483
PRI83 11 1104292429
PRI84 67 1068212420
PRI85 10 1107843258
PRI86 14 1127464071
PRI87 306 1053659872
PRI88 16 1119162041
PRI89 223 1107213108
PRI9 114467 822454647
PRI90 13 1166110364
PRI91 32 1160815068
PRI92 428 1058620120
PRI93 17 1163742934
PRI94 12 1020059052
PRI95 95 1116707204
PRI96 18 1132868537
PRI97 11 1162762611
PRI98 13 1074540305
PRI99 9 1103306497
ROD1 42159 1008837853
ROD10 163 1166541022
ROD100 8 1139757719
ROD101 9 1174668373
ROD102 7 1067359328
ROD103 10 1182029473
ROD104 4 959918585
ROD105 6 1044932681
ROD106 68 1124872912
ROD107 10 1133876088
ROD108 19 1182564383
ROD109 10 1092721418
ROD11 7 1078339014
ROD110 16 1182453566
ROD111 12 1081345329
ROD112 9 1086039483
ROD113 7 934030466
ROD114 3 957465392
ROD115 37237 1082173559
ROD12 90 1160576642
ROD13 9 1118724328
ROD14 15 1161179778
ROD15 16 1135825973
ROD16 72442 1036109422
ROD17 27332 1037444954
ROD18 12 1120355466
ROD19 8 1163882538
ROD2 5909 1093927363
ROD20 12 1101462594
ROD21 7 1065740602
ROD22 110 1130872454
ROD23 10 1095487923
ROD24 8 1173337133
ROD25 8 1063713588
ROD26 9 1146396098
ROD27 10 1068290457
ROD28 8 1081733625
ROD29 11 1082140969
ROD3 6339 1107756976
ROD30 10 1147232155
ROD31 10 1171959357
ROD32 7 1110074623
ROD33 10 1164218519
ROD34 9 1108644203
ROD35 8 1072581452
ROD36 10 1046751576
ROD37 8 1141423843
ROD38 11 1027724205
ROD39 10 1152345994
ROD4 110071 874880522
ROD40 8 1082920857
ROD41 8 1089063230
ROD42 9 1143097394
ROD43 10 1072150743
ROD44 8 1099764473
ROD45 11 1087836125
ROD46 8 1171715672
ROD47 12 1136130400
ROD48 7 1113098900
ROD49 10 1162104909
ROD5 368983 428108843
ROD50 9 1083630069
ROD51 9 1170482326
ROD52 11 1099809287
ROD53 10 1145640092
ROD54 9 1132503232
ROD55 10 1140056814
ROD56 19 1075143845
ROD57 10 1147351773
ROD58 19 1151436343
ROD59 10 1088581837
ROD6 6 1107651413
ROD60 16 1164391722
ROD61 12 1073032075
ROD62 9 1157194591
ROD63 14 1023016171
ROD64 7 1166266691
ROD65 9 1087901740
ROD66 9 1097713367
ROD67 9 1154691504
ROD68 9 1025612394
ROD69 7 1082392531
ROD7 9 1154552993
ROD70 10 1140331137
ROD71 9 1166871002
ROD72 14 1168528777
ROD73 8 1126440038
ROD74 12 1149086196
ROD75 10 1051885153
ROD76 12 1161926762
ROD77 11 1086828534
ROD78 10 1148564844
ROD79 12 1022809212
ROD8 10 1090080857
ROD80 8 1104739191
ROD81 14 1038854127
ROD82 7 1113949024
ROD83 14 1147316566
ROD84 9 1098255843
ROD85 13 1183189045
ROD86 11 1140514852
ROD87 14 1175080086
ROD88 13 1051083644
ROD89 9 1156825032
ROD9 7 1101532017
ROD90 52 1118266047
ROD91 12 1173398982
ROD92 18 1154143271
ROD93 11 1123323681
ROD94 18 1080123782
ROD95 11 1146173548
ROD96 148 1098231299
ROD97 7 1166537123
ROD98 12 1154027383
ROD99 11 1029292292
STS1 422715 213740430
STS2 348961 243834771
STS3 575312 183347936
SYN1 54450 995654191
SYN10 2042 7249510
SYN2 10 1040305979
SYN3 6 1076407027
SYN4 9 1128400530
SYN5 10 1040305979
SYN6 6 1076407027
SYN7 332 916953815
SYN8 80344 882856020
SYN9 180747 726826970
TSA1 675528 274465015
TSA10 491163 443594454
TSA11 464169 476082789
TSA12 540301 380873484
TSA13 535765 387182988
TSA14 552031 395826682
TSA15 499194 393860106
TSA16 462155 345227885
TSA17 529516 428930496
TSA18 455524 496204015
TSA19 550474 444875001
TSA2 551981 321350516
TSA20 478200 355262406
TSA21 423832 348587418
TSA22 491575 422475674
TSA23 489985 425559693
TSA24 503049 447571038
TSA25 551522 412923590
TSA26 320254 599225881
TSA27 321626 516972849
TSA28 213060 240557528
TSA29 247902 86015578
TSA3 516598 398806258
TSA30 255041 65167176
TSA31 493156 400388180
TSA32 391141 545623034
TSA33 368387 574981959
TSA34 423080 474033630
TSA35 420416 476254586
TSA36 451382 415298544
TSA37 55987 33184777
TSA4 505646 416286608
TSA5 500719 360224396
TSA6 584826 316637773
TSA7 573575 366126568
TSA8 593046 269968508
TSA9 537002 422963238
UNA1 775 4564014
VRL1 351163 457346981
VRL10 184589 670531164
VRL100 35597 648398052
VRL101 23513 658793150
VRL102 25861 662459724
VRL103 24629 665625429
VRL104 22776 658384761
VRL105 22771 663753305
VRL106 22550 662186669
VRL107 22701 663651739
VRL108 22754 662228251
VRL109 25112 658248592
VRL11 235955 540745688
VRL110 22661 663834233
VRL111 22776 661518530
VRL112 25382 662335718
VRL113 23435 663488405
VRL114 23838 663646772
VRL115 24656 662394670
VRL116 25341 662618810
VRL117 24781 669117617
VRL118 24349 665577846
VRL119 24141 666834357
VRL12 236739 536475417
VRL120 24392 666249273
VRL121 23839 666744764
VRL122 23653 665191506
VRL123 23152 669224250
VRL124 24194 665225634
VRL125 23568 663996500
VRL126 27221 660273514
VRL127 24830 664601383
VRL128 23279 664656372
VRL129 22594 660866813
VRL13 165601 572544063
VRL130 27182 660110435
VRL131 24247 665328769
VRL132 23482 665445965
VRL133 23498 666385340
VRL134 26904 665233059
VRL135 23175 662587142
VRL136 24705 664789818
VRL137 25893 661549451
VRL138 25785 667016786
VRL139 26248 670095514
VRL14 68706 653552364
VRL140 25865 661059249
VRL141 23868 667391135
VRL142 26299 660348187
VRL143 25671 664203380
VRL144 30275 655103068
VRL145 23883 663906098
VRL146 24939 662339682
VRL147 25489 664359989
VRL148 23105 665516099
VRL149 29040 665762423
VRL15 73945 633776979
VRL150 24788 662078788
VRL151 23958 665535128
VRL152 23178 672546757
VRL153 24329 666128763
VRL154 24669 668621800
VRL155 23837 671094106
VRL156 23066 673085220
VRL157 30595 658126039
VRL158 30403 661334620
VRL159 26097 667126611
VRL16 44089 655866629
VRL160 31771 658940516
VRL161 25489 669208938
VRL162 27919 662867976
VRL163 29543 661618898
VRL164 25870 659426862
VRL165 24926 665610209
VRL166 28145 663448366
VRL167 33056 654277478
VRL168 32104 656169997
VRL169 28030 663577924
VRL17 28020 664799749
VRL170 24000 671598280
VRL171 25747 679858924
VRL172 24766 674479642
VRL173 26982 662713863
VRL174 36713 654306293
VRL175 32516 671016022
VRL176 38528 660492400
VRL177 27951 665810170
VRL178 43097 660068037
VRL179 40158 657375316
VRL18 28548 663445487
VRL180 32016 670527089
VRL181 32342 669258591
VRL182 24644 666072817
VRL183 31903 665288125
VRL184 36000 664377119
VRL185 31267 662443071
VRL186 45301 654978122
VRL187 36154 666612434
VRL188 27903 667081232
VRL189 35577 933395437
VRL19 32677 658711137
VRL190 37196 1111311495
VRL191 37924 1131263375
VRL192 38035 1133705849
VRL193 37732 1125728728
VRL194 37573 1120994349
VRL195 37268 1113213571
VRL196 37186 1110993554
VRL197 37230 1112130992
VRL198 37116 1111698013
VRL199 36854 1100626669
VRL2 132772 576335489
VRL20 27182 659268345
VRL200 36915 1103224422
VRL201 37098 1107208799
VRL202 37057 1106393557
VRL203 37057 1107043260
VRL204 37122 1108793790
VRL205 37130 1109452820
VRL206 37035 1106601069
VRL207 37080 1108176665
VRL208 37026 1106497670
VRL209 36991 1105566185
VRL21 35836 653257028
VRL210 36242 1083186512
VRL211 36975 1104660431
VRL212 36960 1104303801
VRL213 37462 1118058840
VRL214 37205 1111255193
VRL215 37055 1106818570
VRL216 37092 1107413331
VRL217 36942 1104451468
VRL218 37310 1114142628
VRL219 37093 1108537709
VRL22 23939 660130427
VRL220 37394 1115523032
VRL221 37433 1117354347
VRL222 37122 1109056477
VRL223 36960 1103864003
VRL224 37404 1116083601
VRL225 37229 1111543424
VRL226 37123 1108521217
VRL227 37043 1106448390
VRL228 37244 1111816768
VRL229 36959 1104056334
VRL23 24202 662591034
VRL230 36870 1101444230
VRL231 36983 1104295218
VRL232 37261 1111568199
VRL233 37054 1106504601
VRL234 36960 1104047862
VRL235 36998 1105156023
VRL236 37072 1107426960
VRL237 37550 1117137768
VRL238 37169 1110327172
VRL239 37277 1113614346
VRL24 30460 657556062
VRL240 37023 1105743030
VRL241 37065 1106937457
VRL242 37129 1108683235
VRL243 37000 1104888497
VRL244 36624 1093732420
VRL245 37085 1107177939
VRL246 37089 1107210333
VRL247 37094 1107298828
VRL248 37179 1109980414
VRL249 37525 1118264367
VRL25 23732 661592572
VRL250 37446 1118386668
VRL251 37384 1116511779
VRL252 37128 1108639346
VRL253 36975 1104127358
VRL254 36336 1084546200
VRL255 36640 1093322201
VRL256 37831 1127440457
VRL257 37711 1123944076
VRL258 37953 1129080274
VRL259 37720 1123340273
VRL26 23850 665384731
VRL260 37875 1127211413
VRL261 37840 1127691873
VRL262 37473 1116795408
VRL263 37975 1129923194
VRL264 37507 1119418241
VRL265 37579 1124404078
VRL266 36824 1099634119
VRL267 37308 1109286941
VRL268 37559 1121751058
VRL269 37581 1122546965
VRL27 23446 664445485
VRL270 37601 1123092786
VRL271 37131 1108910456
VRL272 37342 1116723094
VRL273 37048 1110186296
VRL274 37406 1100218216
VRL275 38033 1095173193
VRL276 36411 1082607631
VRL277 35938 1073727741
VRL278 36312 1085105631
VRL279 36328 1085790592
VRL28 24858 663510887
VRL280 36351 1085662034
VRL281 36167 1080326840
VRL282 36512 1090437631
VRL283 36470 1088834012
VRL284 36502 1089755440
VRL285 36484 1089295006
VRL286 36479 1089148549
VRL287 36502 1089797128
VRL288 36728 1095369010
VRL289 37070 1104317446
VRL29 26123 663152003
VRL290 36769 1096949868
VRL291 37529 1116231358
VRL292 38129 1131922850
VRL293 38153 1132801501
VRL294 38084 1131222485
VRL295 38107 1131481264
VRL296 38119 1132021239
VRL297 38157 1132860932
VRL298 38529 1099723865
VRL299 36454 1088548841
VRL3 315173 427394652
VRL30 29416 666340838
VRL300 36520 1091363625
VRL301 36669 1095361968
VRL302 36584 1092917173
VRL303 36586 1092960957
VRL304 36583 1092869088
VRL305 36587 1093003251
VRL306 36267 1083700902
VRL307 36054 1075551482
VRL308 36120 1076009011
VRL309 35970 1066781696
VRL31 31223 662949289
VRL310 36850 1090758377
VRL311 37548 1119906072
VRL312 37474 1119252745
VRL313 36470 1089742182
VRL314 35842 1070915794
VRL315 36015 1076169223
VRL316 39075 1089956859
VRL317 39173 1091135878
VRL318 38619 1103579640
VRL319 37255 1067102875
VRL32 26570 665908367
VRL320 27174 668234280
VRL321 26334 675387685
VRL322 31062 667265402
VRL323 32545 666051283
VRL324 48366 655927265
VRL325 55718 645130936
VRL326 35031 658515394
VRL327 71313 630802301
VRL328 48471 658956016
VRL329 41236 657330964
VRL33 24648 665573590
VRL330 25462 676375363
VRL331 46555 660171508
VRL332 37163 658404905
VRL333 64519 639617960
VRL334 44927 655544236
VRL335 22374 666755169
VRL336 55792 645330793
VRL337 43026 114109709
VRL34 24232 664737695
VRL35 25582 664211675
VRL36 23559 658062670
VRL37 22813 664084532
VRL38 23340 661849925
VRL39 24276 659168651
VRL4 278041 596544461
VRL40 32761 975686753
VRL41 37096 1109183050
VRL42 37110 1109193218
VRL43 37133 1109657533
VRL44 29733 875266761
VRL45 23554 665728855
VRL46 24346 663761880
VRL47 22706 659075976
VRL48 22773 658308620
VRL49 23035 663553805
VRL5 324863 471846427
VRL50 23420 659170695
VRL51 22506 663520164
VRL52 22803 663865775
VRL53 22600 660600166
VRL54 23345 664323203
VRL55 23501 667392082
VRL56 22597 661227052
VRL57 22784 665190244
VRL58 22872 664704967
VRL59 22372 661253414
VRL6 283392 468803223
VRL60 24698 666021469
VRL61 23313 659445078
VRL62 24616 669196657
VRL63 24323 665774968
VRL64 22512 660477284
VRL65 24364 668344693
VRL66 22784 663988577
VRL67 23593 664392478
VRL68 25501 662532433
VRL69 22491 661544447
VRL7 252211 510500827
VRL70 23266 664571125
VRL71 23036 664544386
VRL72 22342 662398418
VRL73 23277 667407387
VRL74 23781 664531537
VRL75 23227 664514649
VRL76 23204 664633191
VRL77 23479 660683369
VRL78 25313 664857368
VRL79 22318 663808233
VRL8 261339 494921682
VRL80 23309 666025257
VRL81 23149 664977434
VRL82 22806 665341841
VRL83 22985 665032169
VRL84 23334 664557335
VRL85 22368 662428439
VRL86 22374 665593884
VRL87 22767 667420846
VRL88 22617 661638366
VRL89 22746 673396670
VRL9 248829 528221112
VRL90 23105 664262904
VRL91 22458 664777864
VRL92 23158 665289144
VRL93 22771 668702771
VRL94 22851 660847959
VRL95 28246 671218345
VRL96 23570 665797365
VRL97 22923 663229914
VRL98 24750 663742594
VRL99 23593 661558541
VRT1 151994 879103124
VRT10 20 1009905601
VRT100 29 1171515081
VRT101 38 1169813989
VRT102 114 674068324
VRT103 2 806190538
VRT104 2 696540660
VRT105 4 904864528
VRT106 44 1019397561
VRT107 36 1178642032
VRT108 61 1042460441
VRT109 153 1133976286
VRT11 41 1100928095
VRT110 20 1151700990
VRT111 66 1177342711
VRT112 63 1011340213
VRT113 5 1114313003
VRT114 40 1121950258
VRT115 26 1165870027
VRT116 34 993803116
VRT117 10 863470745
VRT118 99 1055299498
VRT119 45 1173161375
VRT12 5 1148517812
VRT120 34 1154532236
VRT121 37 1165711270
VRT122 20 1174931749
VRT123 18 1153973849
VRT124 22 1182636590
VRT125 312 1171570949
VRT126 40 1165814453
VRT127 41 1170464824
VRT128 19 1155157253
VRT129 42 1177238185
VRT13 35 1166286255
VRT130 40 1181828030
VRT131 52 1166638748
VRT132 30 1154120422
VRT133 26 1093949723
VRT134 25 1160740832
VRT135 37 1158359519
VRT136 24 1031287813
VRT137 48 1177450183
VRT138 37 1168924425
VRT139 18 1164074289
VRT14 42 1147063015
VRT140 26 1182902339
VRT141 39 1133969144
VRT142 36 1168754407
VRT143 31 1163137436
VRT144 36 1170882423
VRT145 36 1152871582
VRT146 21 1177136033
VRT147 17 1131769706
VRT148 40 1099550703
VRT149 14 1151376722
VRT15 21 1181026761
VRT150 40 1181857143
VRT151 43 1118286302
VRT152 21 1172396618
VRT153 21 1159704045
VRT154 37 1180805679
VRT155 36 1074349268
VRT156 305 1147865056
VRT157 37 1155455580
VRT158 53 1170748576
VRT159 39 1042530955
VRT16 32 1154008905
VRT160 5 1145352964
VRT161 8 1166817677
VRT162 22 1099238862
VRT163 24 1181050320
VRT164 28 1128461858
VRT165 23 1179977145
VRT166 17 1140261904
VRT167 47 1162361489
VRT168 33 1082875689
VRT169 40 1151038532
VRT17 28 1125628677
VRT170 35 1168555234
VRT171 21 1052433236
VRT172 5 1056736991
VRT173 8 1141521528
VRT174 13 1130579885
VRT175 20 1160195610
VRT176 50 1171449262
VRT177 36 1181564440
VRT178 159 1113225433
VRT179 22 1003732213
VRT18 25163 1108372115
VRT180 42 1170859841
VRT181 43 1076296835
VRT182 41 1138566252
VRT183 14 1179788972
VRT184 13 1137303478
VRT185 17 1162516663
VRT186 15 1104770266
VRT187 16 1019314169
VRT188 23 1178565343
VRT189 37 1182347574
VRT19 385332 549062519
VRT190 50 1134087574
VRT191 24 926554202
VRT192 4 1160654489
VRT193 6 1055180276
VRT194 11 1145381641
VRT195 18 1181285424
VRT196 15 1146666012
VRT197 27 1182848304
VRT198 21 1151141727
VRT199 16 1122899890
VRT2 30 1174650673
VRT20 70257 1061768668
VRT200 42 1156993143
VRT201 18 1168032833
VRT202 24 1179938402
VRT203 27 1158754540
VRT204 31 1171954388
VRT205 14 1058831880
VRT206 7 1098198485
VRT207 10 1112454070
VRT208 21 982002519
VRT209 10 1173938281
VRT21 513290 359495516
VRT210 28 1176020601
VRT211 41 1179233542
VRT212 101 1118100577
VRT213 88 1107333274
VRT214 92 1110353805
VRT215 75 1110401066
VRT216 47 1183640734
VRT217 58 1143023906
VRT218 33 701808784
VRT219 1 1377224146
VRT22 474827 349732233
VRT220 1 1246042375
VRT221 1 1134302525
VRT222 1 1092803421
VRT223 1 995116563
VRT224 1 979649957
VRT225 3 1100551194
VRT226 3 511216884
VRT227 1 1415942608
VRT228 1 1279781030
VRT229 1 1144564707
VRT23 538166 342758582
VRT230 1 1114117749
VRT231 1 1027171557
VRT232 1 998592877
VRT233 3 1103810273
VRT234 4 510174135
VRT235 1 1950672471
VRT236 1 1882935974
VRT237 1 1702342136
VRT238 1 1361375652
VRT239 1 1317398316
VRT24 212628 811800662
VRT240 1 1293891082
VRT241 1 1269970046
VRT242 1 1248769876
VRT243 1 1238911699
VRT244 1 1201415365
VRT245 1 1199165587
VRT246 1 1184551933
VRT247 1 1183987023
VRT248 1 1134708421
VRT249 1 1024245046
VRT25 326534 856343202
VRT250 1 993383533
VRT251 3 1080922639
VRT252 39 1080538033
VRT253 42 1162049517
VRT254 43 1144321272
VRT255 19 1033892758
VRT256 8 1159899222
VRT257 12 1157225835
VRT258 19 1098867675
VRT259 15 1097791464
VRT26 3687 1175345842
VRT260 18 1112130599
VRT261 34 1182680941
VRT262 17 1164381965
VRT263 34 1077194331
VRT264 34 1012246650
VRT265 33 1009704254
VRT266 8 201061856
VRT267 1 2146314909
VRT268 1 459926735
VRT269 1 2140055507
VRT27 13325 1148233300
VRT270 1 526359502
VRT271 1 2132484007
VRT272 1 510744347
VRT273 1 2141402031
VRT274 1 154081089
VRT275 1 2143815925
VRT276 1 17068361
VRT277 1 2139332349
VRT278 1 1965638399
VRT279 1 1730884321
VRT28 41 1166851205
VRT280 1 1292683186
VRT281 1 1220333517
VRT282 1 1209226565
VRT283 7 1134997840
VRT284 26 1123273225
VRT285 25 1160795076
VRT286 6 147321427
VRT287 1 2144885605
VRT288 1 368539449
VRT289 1 2136077662
VRT29 46 1150892342
VRT290 1 338547956
VRT291 1 2137795666
VRT292 1 330263317
VRT293 1 2145962954
VRT294 1 25971532
VRT295 1 2035433746
VRT296 1 1925992481
VRT297 1 1778043439
VRT298 1 1581089616
VRT299 1 1245844088
VRT3 123 1174179528
VRT30 267 1176985612
VRT300 1 1157923350
VRT301 1 1112128736
VRT302 2 1122751352
VRT303 11 1154196115
VRT304 44 1172047204
VRT305 24 1172348617
VRT306 18 1176756695
VRT307 32 1112452156
VRT308 33 1117361619
VRT309 7 1120783487
VRT31 5 1061161967
VRT310 41 1174844090
VRT311 42 1145319211
VRT312 50 1118086011
VRT313 46 858628186
VRT314 5 1183989260
VRT315 39 1181983406
VRT316 16 1169772349
VRT317 33 1168068530
VRT318 39 1178015384
VRT319 26 1170900792
VRT32 4 1006655652
VRT320 25 876627647
VRT321 5 1166202874
VRT322 35 1177396247
VRT323 12 1138737328
VRT324 24 1137207669
VRT325 25 1145244149
VRT326 18 1156560173
VRT327 15 1160306418
VRT328 18 1179091566
VRT329 5 1101265415
VRT33 7 1156267552
VRT330 23 1021791390
VRT331 1 896647653
VRT332 1 751834319
VRT333 1 688568912
VRT334 1 677924506
VRT335 2 898565348
VRT336 4 1121318331
VRT337 6 1111589716
VRT338 41 1164732652
VRT339 7 1146761244
VRT34 26 1162615118
VRT340 21 1066338465
VRT341 7 1134566935
VRT342 21 1068252028
VRT343 7 1133695910
VRT344 21 1068641290
VRT345 7 1139083692
VRT346 22 1064139134
VRT347 7 1135127699
VRT348 21 1072078992
VRT349 7 1132643145
VRT35 43 1179641806
VRT350 22 1065553763
VRT351 41 1139882337
VRT352 41 1134645266
VRT353 7 1111229456
VRT354 21 1031013239
VRT355 7 1135497343
VRT356 22 1070839852
VRT357 7 1132117858
VRT358 21 1072202009
VRT359 7 1115661213
VRT36 30 561601148
VRT360 25 1130603089
VRT361 34 1108251824
VRT362 33 1078433855
VRT363 32 1102576659
VRT364 33 1122931389
VRT365 36 1119127885
VRT366 26 1114623931
VRT367 14 1111480876
VRT368 35 1165025012
VRT369 79707 150424315
VRT37 1 839681426
VRT38 1 825560060
VRT39 2 1082779519
VRT4 106339 999206364
VRT40 3 1072075408
VRT41 8 1112968075
VRT42 21 1180520471
VRT43 22 1158850226
VRT44 353 1181688611
VRT45 28 1098865212
VRT46 1 662004353
VRT47 2 911653698
VRT48 3 1021932445
VRT49 490 1179856557
VRT5 72669 919267796
VRT50 30 1161799788
VRT51 24 1180126066
VRT52 24 1139184549
VRT53 40 1180636041
VRT54 72 1164816936
VRT55 7 1156606571
VRT56 3 1012738546
VRT57 6 1130561284
VRT58 468 1183012903
VRT59 10 1163204068
VRT6 38 1174624699
VRT60 618 1178963146
VRT61 13 971142702
VRT62 5 1115794738
VRT63 6 1049980901
VRT64 34 1152243713
VRT65 20 1141871979
VRT66 38 1132348904
VRT67 226 1180434283
VRT68 21 1114739427
VRT69 21 1172326162
VRT7 42 1157042340
VRT70 53 1183886833
VRT71 20 1122316722
VRT72 17 1136974292
VRT73 22 1140340918
VRT74 23 1161212858
VRT75 23 1154719176
VRT76 119 1154956026
VRT77 90 1170752658
VRT78 16 447555359
VRT79 1 843366180
VRT8 52 1150524292
VRT80 1 842558404
VRT81 1 707956555
VRT82 1 635713434
VRT83 2 1006930617
VRT84 6 953838719
VRT85 1 690654357
VRT86 2 1036857559
VRT87 3 1135937014
VRT88 37 1176417013
VRT89 4327 1133387875
VRT9 35 1139739741
VRT90 241646 732026179
VRT91 406131 401514375
VRT92 253098 595072344
VRT93 72 1183885388
VRT94 46 1159399889
VRT95 25 1169635560
VRT96 48 1172429944
VRT97 397 1151363890
VRT98 61 1180749347
VRT99 40 1180462495
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 265.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:
Entries Bases Species
28167259 774219864025 Homo sapiens
1945905 311342299663 Triticum aestivum
9090733 270414697376 Severe acute respiratory syndrome coronavirus 2
113565 246951186638 Hordeum vulgare
753 212675690135 Hordeum bulbosum
1346950 125991526699 Hordeum vulgare subsp. vulgare
164 93011095388 Viscum album
29876 92980158773 Hordeum vulgare subsp. spontaneum
10105939 46322443168 Mus musculus
185429 32649073783 Escherichia coli
2641291 23969420166 Arabidopsis thaliana
504 22852581183 Lissotriton helveticus
1627 22052873125 Triturus cristatus
38837 22010079997 Klebsiella pneumoniae
1343 21278745710 Lissotriton vulgaris
29831 21128017447 Avena sativa
1552 20633304337 Chenopodium quinoa
553738 20142063929 Capra hircus
785 17031745677 Bombina variegata
2244904 16211260457 Bos taurus
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting. Also note that this table is limited
to 'traditional', non-set-based (WGS/TSA/TLS) GenBank records.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
190 Jun 2012 141343240755 154130210
191 Aug 2012 143081765233 156424033
192 Oct 2012 145430961262 157889737
193 Dec 2012 148390863904 161140325
194 Feb 2013 150141354858 162886727
195 Apr 2013 151178979155 164136731
196 Jun 2013 152599230112 165740164
197 Aug 2013 154192921011 167295840
198 Oct 2013 155176494699 168335396
199 Dec 2013 156230531562 169331407
200 Feb 2014 157943793171 171123749
201 Apr 2014 159813411760 171744486
202 Jun 2014 161822845643 173353076
203 Aug 2014 165722980375 174108750
204 Oct 2014 181563676918 178322253
205 Dec 2014 184938063614 179295769
206 Feb 2015 187893826750 181336445
207 Apr 2015 189739230107 182188746
208 Jun 2015 193921042946 185019352
209 Aug 2015 199823644287 187066846
210 Oct 2015 202237081559 188372017
211 Dec 2015 203939111071 189232925
212 Feb 2016 207018196067 190250235
213 Apr 2016 211423912047 193739511
214 Jun 2016 213200907819 194463572
215 Aug 2016 217971437647 196120831
216 Oct 2016 220731315250 197390691
217 Dec 2016 224973060433 198565475
218 Feb 2017 228719437638 199341377
219 Apr 2017 231824951552 200877884
220 Jun 2017 234997362623 201663568
221 Aug 2017 240343378258 203180606
222 Oct 2017 244914705468 203953682
223 Dec 2017 249722163594 206293625
224 Feb 2018 253630708098 207040555
225 Apr 2018 260189141631 208452303
226 Jun 2018 263957884539 209775348
227 Aug 2018 260806936411 208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
228 Oct 2018 279668290132 209656636
229 Dec 2018 285688542186 211281415
230 Feb 2019 303709510632 212260377
231 Apr 2019 321680566570 212775414
232 Jun 2019 329835282370 213383758
233 Aug 2019 366733917629 213865349
234 Oct 2019 386197018538 216763706
235 Dec 2019 388417258009 215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
236 Feb 2020 399376854872 216214215
237 Apr 2020 415770027949 216531829
238 Jun 2020 427823258901 217122233
239 Aug 2020 654057069549 218642238
240 Oct 2020 698688094046 219055207
241 Dec 2020 723003822007 221467827
242 Feb 2021 776291211106 226241476
243 Apr 2021 832400799511 227123201
244 Jun 2021 866009790959 227888889
245 Aug 2021 940513260726 231982592
246 Oct 2021 1014763752113 233642893
247 Dec 2021 1053275115030 234557297
248 Feb 2022 1173984081721 236338284
249 Apr 2022 1266154890918 237520318
250 Jun 2022 1395628631187 239017893
251 Aug 2022 1492800704497 239915786
252 Oct 2022 1562963366851 240539282
253 Dec 2022 1635594138493 241015745
254 Feb 2023 1731302248418 241830635
255 Apr 2023 1826746318813 242554936
256 Jun 2023 1966479976146 243560863
257 Aug 2023 2112058517945 246119175
258 Oct 2023 2433391164875 247777761
259 Dec 2023 2570711588044 249060436
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 3213818003787 250803006
261 Jun 2024 3387240663231 251094334
262 Aug 2024 3675462701077 251998350
263 Oct 2024 4250942573681 252347664
264 Dec 2024 5085904976338 254365075
265 Feb 2025 5415448651743 255669865
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
190 Jun 2012 287577367116 82076779
191 Aug 2012 308196411905 84020064
192 Oct 2012 333881846451 86480509
193 Dec 2012 356002922838 92767765
194 Feb 2013 390900990416 103101291
195 Apr 2013 418026593606 110509314
196 Jun 2013 453829752320 112488036
197 Aug 2013 500420412665 124812020
198 Oct 2013 535842167741 130203205
199 Dec 2013 556764321498 133818570
200 Feb 2014 591378698544 139725795
201 Apr 2014 621015432437 143446790
202 Jun 2014 719581958743 175779064
203 Aug 2014 774052098731 189080419
204 Oct 2014 805549167708 196049974
205 Dec 2014 848977922022 200301550
206 Feb 2015 873281414087 205465046
207 Apr 2015 969102906813 243779199
208 Jun 2015 1038937210221 258702138
209 Aug 2015 1163275601001 302955543
210 Oct 2015 1222635267498 309198943
211 Dec 2015 1297865618365 317122157
212 Feb 2016 1399865495608 333012760
213 Apr 2016 1452207704949 338922537
214 Jun 2016 1556175944648 350278081
215 Aug 2016 1637224970324 359796497
216 Oct 2016 1676238489250 363213315
217 Dec 2016 1817189565845 395301176
218 Feb 2017 1892966308635 409490397
219 Apr 2017 2035032639807 451840147
220 Jun 2017 2164683993369 487891767
221 Aug 2017 2242294609510 499965722
222 Oct 2017 2318156361999 508825331
223 Dec 2017 2466098053327 551063065
224 Feb 2018 2608532210351 564286852
225 Apr 2018 2784740996536 621379029
226 Jun 2018 2944617324086 639804105
227 Aug 2018 3204855013281 665309765
228 Oct 2018 3444172142207 722438528
229 Dec 2018 3656719423096 773773190
230 Feb 2019 4164513961679 945019312
231 Apr 2019 4421986382065 993732214
232 Jun 2019 4847677297950 1022913321
233 Aug 2019 5585922333160 1075272215
234 Oct 2019 5985250251028 1097629174
235 Dec 2019 6277551200690 1127023870
236 Feb 2020 6968991265752 1206720688
237 Apr 2020 7788133221338 1267547429
238 Jun 2020 8114046262158 1302852615
239 Aug 2020 8841649410652 1408122887
240 Oct 2020 9215815569509 1432874252
241 Dec 2020 11830842428018 1517995689
242 Feb 2021 12270717209612 1563938043
243 Apr 2021 12732048052023 1590670459
244 Jun 2021 13442974346437 1632796606
245 Aug 2021 13888187863722 1653427055
246 Oct 2021 14599101574547 1721064101
247 Dec 2021 14922033922302 1734664952
248 Feb 2022 15428122140820 1750505007
249 Apr 2022 16071520702170 1781374217
250 Jun 2022 16710373006600 1796349114
251 Aug 2022 17511809676629 2024099677
252 Oct 2022 18231960808828 2167900306
253 Dec 2022 19086596616569 2241439349
254 Feb 2023 20116642176263 2337838461
255 Apr 2023 20926504760221 2440470464
256 Jun 2023 21791125594114 2611654455
257 Aug 2023 22294446104543 2631493489
258 Oct 2023 23600199887231 2775205599
259 Dec 2023 24651580464335 2863228552
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 27225116587937 3333621823
261 Jun 2024 27900199328333 3380877515
262 Aug 2024 29643594176326 3569715357
263 Oct 2024 31362454467668 3745772758
264 Dec 2024 32983029087303 3957195833
265 Feb 2025 35643977584264 4152691448
The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.
TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).
Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.
Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tsa
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.
Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.
Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.
Release Date Base Pairs Entries
201 Apr 2014 23632325832 29734989
202 Jun 2014 31707343431 38011942
203 Aug 2014 33676182560 40556905
204 Oct 2014 36279458440 43567759
205 Dec 2014 46056420903 62635617
206 Feb 2015 49765340047 66706014
207 Apr 2015 55796332435 71989588
208 Jun 2015 60697472570 76974601
209 Aug 2015 69360654413 87827013
210 Oct 2015 70917172944 81790031
211 Dec 2015 77583339176 87488539
212 Feb 2016 81932555094 92132318
213 Apr 2016 87811163676 98147566
214 Jun 2016 94413958919 104677061
215 Aug 2016 103399742586 113179607
216 Oct 2016 113209225762 124199597
217 Dec 2016 125328824508 142094337
218 Feb 2017 133517212104 151431485
219 Apr 2017 149038907599 165068542
220 Jun 2017 158112969073 176812130
221 Aug 2017 167045663417 186777106
222 Oct 2017 172909268535 192754804
223 Dec 2017 181394660188 201559502
224 Feb 2018 193940551226 214324264
225 Apr 2018 205232396043 227364990
226 Jun 2018 216556686631 238788334
227 Aug 2018 225520004678 249295386
228 Oct 2018 235875573598 259927414
229 Dec 2018 248592892188 274845473
230 Feb 2019 263936885705 294772430
231 Apr 2019 277118019688 311247136
232 Jun 2019 285390240861 319927264
233 Aug 2019 294727165179 331347807
234 Oct 2019 305371891408 342811151
235 Dec 2019 325433016129 367193844
236 Feb 2020 340994289065 386644871
237 Apr 2020 349692751528 396392280
238 Jun 2020 359947709062 409725050
239 Aug 2020 366968951160 417524567
240 Oct 2020 382996662270 435968379
241 Dec 2020 392206975386 446397378
242 Feb 2021 407605409948 463151000
243 Apr 2021 425076483459 481154920
244 Jun 2021 436594941165 494641358
245 Aug 2021 440578422611 498305045
246 Oct 2021 449891016597 508319391
247 Dec 2021 455870853358 514158576
248 Feb 2022 465013156502 524464601
249 Apr 2022 474421076448 534770586
250 Jun 2022 485056129761 546991572
251 Aug 2022 497501380386 560196830
252 Oct 2022 511476787957 574020080
253 Dec 2022 611850391049 649918843
254 Feb 2023 630615054587 672261981
255 Apr 2023 636291358227 678332682
256 Jun 2023 643127590034 683922756
257 Aug 2023 646176166908 686271945
258 Oct 2023 659924904311 701336089
259 Dec 2023 668807109326 715803123
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 689648317082 741066498
261 Jun 2024 695405769319 746753803
262 Aug 2024 706085554263 755907377
263 Oct 2024 812661461811 948733596
264 Dec 2024 820128973511 957403887
265 Feb 2025 824439978941 961491801
The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.
Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
ftp://ftp.ncbi.nih.gov/genbank/tls
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.
Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.
Release Date Base Pairs Entries
217 Dec 2016 584697919 1268690
218 Feb 2017 636923295 1438349
219 Apr 2017 636923295 1438349 (unchanged)
220 Jun 2017 824191338 1628475
221 Aug 2017 824191338 1628475 (unchanged)
222 Oct 2017 2993818315 9479460
223 Dec 2017 4458042616 12695198
224 Feb 2018 4531966831 12819978
225 Apr 2018 5612769448 14782654
226 Jun 2018 5896511468 15393041
227 Aug 2018 6077824493 15822538
228 Oct 2018 8435112913 20752288
229 Dec 2018 8511829281 20924588
230 Feb 2019 9146836085 23259929
231 Apr 2019 9623321565 24240761
232 Jun 2019 10182427815 25530139
233 Aug 2019 10531800829 26363945
234 Oct 2019 10848455369 27460978
235 Dec 2019 11280596614 28227180
236 Feb 2020 13669678196 34037371
237 Apr 2020 24615270313 65521132
238 Jun 2020 27500635128 75063181
239 Aug 2020 27825059498 75682157
240 Oct 2020 28814798868 78177358
241 Dec 2020 33036509446 88039152
242 Feb 2021 33634122995 90130561
243 Apr 2021 37998534461 102395753
244 Jun 2021 38198113354 102662929
245 Aug 2021 39930167315 106995218
246 Oct 2021 40168874815 107569935
247 Dec 2021 41143480750 109379021
248 Feb 2022 41321107981 109809966
249 Apr 2022 41324192343 109820387
250 Jun 2022 41999358847 111142107
251 Aug 2022 43852280645 115103527
252 Oct 2022 43860512749 115123306
253 Dec 2022 44009657455 115552377
254 Feb 2023 46465508548 121067644
255 Apr 2023 46567924833 121186672
256 Jun 2023 47302831210 122798571
257 Aug 2023 48289699026 124421006
258 Oct 2023 50868407906 130654568
259 Dec 2023 51568356978 132355132
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 53492243256 135115766
261 Jun 2024 54512778803 135446337
262 Aug 2024 77026446552 187321998 Spike caused by restoration of stats for the Aug 2021 KEQH TLS project : 48-mln records
263 Oct 2024 77037504468 187349395
264 Dec 2024 77038271475 187349466
265 Feb 2025 78062322564 189703939
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`month day year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
February 15 2025
NCBI-GenBank Flat File Release 265.0
Bacterial Sequences (Part 1)
179374 loci, 601308029 bases, from 179374 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.
NOTE : Presentation of GI sequence identifiers in the GenBank
flatfile format was discontinued as of March 2017.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, possibly 'LINEAGE'. But because changes like this can be
very disruptive for customers, implementation has not yet been scheduled.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
3.4.4.1 : Important notice about parsing the LOCUS line
Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.
Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.
Consider this LOCUS line for a typical complete bacterial genome:
LOCUS CP032762 5868661 bp DNA circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:
LOCUS AZZZAA02123456789 9999999999 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:
LOCUS AZZZAA0212345678910000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:
LOCUS AZZZAA02123456789 10000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.
3.4.4.2 : Data elements of the LOCUS line
The data elements of the LOCUS line format and their typical/historical
column positions are as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus Name (usually identical to the Accession Number)
29-29 space
30-40 Sequence Length, right-justified
41-41 space
42-43 'bp'
44-44 space
45-47 Strandedness : spaces (if not known), ss- (single-stranded),
ds- (double-stranded), or ms- (mixed-stranded)
48-53 Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), cRNA (viral cRNA)
Left justified.
54-55 space
56-63 Molecule Topology : 'linear' followed by two spaces,
or 'circular'
64-64 space
65-67 Division Code
68-68 space
69-79 Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.
The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :
LOCUS HUMPDNRC 273 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S125 polymorphic dinucleotide repeat.
ACCESSION L10620
LOCUS HUMPDNRG 169 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S114 polymorphic dinucleotide repeat.
ACCESSION L10624
But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:
LOCUS AF035771 1357 bp mRNA linear PRI 30-JUN-1998
DEFINITION Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
complete cds.
ACCESSION AF035771
The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :
PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags)
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites)
GSS - GSS sequences (Genome Survey Sequences)
HTG - HTGS sequences (High Throughput Genomic sequences)
HTC - HTC sequences (High Throughput cDNA sequences)
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences
The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1
^^^^^^^^^^
Compound
Accession.Version
Number
A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:
http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS ANHA01000001 503 bp DNA linear BCT 23-NOV-2012
DEFINITION Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION ANHA01000001 ANHA01000000
VERSION ANHA01000001.1
DBLINK BioProject: PRJNA177352
BioSample: SAMN01795900
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK BioProject:PRJNA174162,PRJNA999998,PRJNA999999
And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.
As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".
DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:
http://www.ncbi.nlm.nih.gov/bioproject
At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:
http://www.ncbi.nlm.nih.gov/books/NBK54016/
DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:
http://www.ncbi.nlm.nih.gov/assembly
At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:
http://www.ncbi.nlm.nih.gov/assembly/help/
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (&lt;10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:
http://www.insdc.org/documents/feature-table
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.2
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols &lt; and &gt; indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols &lt; and &gt; indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
The list of valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.3
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, as of June 2022 the `/exception' qualifier has only four
allowed values: 'RNA editing', 'reasons given in citation', 'rearrangement
required for product', and 'annotated by transcript or proteomic data'.
These are known as controlled vocabulary qualifier values. Controlled
qualifier values are case sensitive.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `&lt;`and `&gt;' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..&gt;66
/note="alpha-1-acid glycoprotein mRNA"
transposon &lt;1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS KZ271580 141308 bp DNA linear CON 17-AUG-2017
DEFINITION Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION KZ271580 LQNL01000000
VERSION KZ271580.1
DBLINK BioProject: PRJNA230512
BioSample: SAMN04226856
KEYWORDS WGS; HIGH_QUALITY_DRAFT.
...
mRNA complement(join(&lt;1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/product="hypothetical protein"
CDS complement(join(&lt;1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/codon_start=1
/product="hypothetical protein"
/protein_id="OZC04795.1"
/db_xref="GI:1233056989"
/translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Scaffold/CON-division join() sequence
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
info@ncbi.nlm.nih.gov
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.
The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov .
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Sayers EW, Cavanaugh M, Clark K, Pruitt KD, Sherry ST, Yankie L,
Karsch-Mizrachi I, "GenBank 2024 update", Nucleic Acids Research,
Volume 52, Issue D1, January 2024, pp. D134-D137.
PMID: 37889039
PMCID: PMC10767886
DOI: 10.1093/nar/gkad903
The following statement is an example of how one might cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'
(1) Sayers, EW. et al, Nucleic Acids Res. 52(D1):D134-D137 (2024)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: Simply direct your web browser of choice to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Genome Workbench can be used to submit revisions to
previous submissions. In addition, suggestions and corrections can
be sent by electronic mail to: update@ncbi.nlm.nih.gov. Please be
certain to indicate the primary accession number of the entry to which
your comments apply; it is helpful if you also give the entry name and
the current contents of any data field for which you are recommending
a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Shelby Bidwell, Larissa Brown,
Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky,
Scott Durkin, Michel Eschenbrenner, Michael Fetchko, Linda Frisse,
Andrea Gocke, Anjanette Johnston, Erica Lam,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley,
Beverly Underwood, and Linda Yankie
GenBank Release Coordination
Mark Cavanaugh
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
Sergiy Gotvyanskyy, Eugene Gribov, Sergei Kalashnikov, Jonathan Kans,
Leonid Khotomliansky, Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh,
Alex Kotliarov, Frank Ludwig, Vasuki Palanigobu, Anton Perkov,
Andriy Petrow, Sergey Petrunin, Dmitrii Saprykin, Wenyao Shi, Denis Sinyakov,
Thomas Smith, Vladimir Soussov, Vitaly Stakhovsky, Elena Starchenko,
Hanzhen Sun, Andrei Vereshchagin, Jewen Xiao, Liwei Zhou
Database Administration
Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
Benjamin Slade, Constantin Vasilyev
Customer Support
David Brodsky, Hanguan Liu, Cooper Park, Monica Romiti, Eric Sayers,
Majda Valjavec-Gratian
Project Direction/Leadership
Steve Sherry : Acting Director, NLM
Kim Pruitt : Acting Director, NCBI
Valerie Schneider : Acting Branch Chief, NCBI/IEB
Eugene Yaschenko : Chief Technology Officer, NCBI/IRB
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
</pre>
</div>
<!--/.col1-->
<div class="col2">
</div>
<!--/.col2-->
<div class="col3">
</div>
<!--/.col3-->
<div class="col4">
</div>
<!--/.col4-->
<div class="col5">
</div>
<div class="col6">
</div>
<div class="col7">
</div>
<div class="col8">
</div>
<div class="col9">
</div>
</div><!--/.content-->
</div><!--/.container-->
<div id="NCBIFooter_dynamic">
<div class="breadcrumbs">You are here:
<span id="breadcrumb_text"><a href="/guide/">NCBI</a></span></div>
<a id="help-desk-link" class="help_desk" href="https://support.ncbi.nlm.nih.gov/ics/support/default.asp?Time=2025-03-18T20:06:40-04:00&amp;Snapshot=%2Fprojects%2Fstaticsites%2Fgenbank%2Fgenbank@2.21&amp;Host=portal107&amp;ncbi_phid=CE8E7A9A7DA027910000000000B900A0&amp;ncbi_session=CE8BC1E97D9F05E1_0182SID&amp;from=https%3A%2F%2Fwww.ncbi.nlm.nih.gov%2Fgenbank%2Frelease%2Fcurrent%2F&amp;Ncbi_App=genbank&amp;Page=static&amp;style=classic&amp;deptID=28049" target="_blank">Support Center</a>
<noscript><img alt="" src="/stat?jsdisabled=true&amp;ncbi_app=genbank&amp;ncbi_db=&amp;ncbi_pdid=static&amp;ncbi_phid=CE8E7A9A7DA027910000000000B900A0" /></noscript>
</div>
<div xmlns:xi="http://www.w3.org/2001/XInclude">
<div xmlns="http://www.w3.org/1999/xhtml" class="footer" id="footer" xml:base="http://127.0.0.1/sites/static/header_footer">
<section class="icon-section">
<div id="icon-section-header" class="icon-section_header">Follow NCBI</div>
<div class="grid-container container">
<div class="icon-section_container">
<a class="footer-icon" id="footer_twitter" href="https://twitter.com/ncbi" aria-label="Twitter">
<svg xmlns="http://www.w3.org/2000/svg" width="40" height="40" viewBox="0 0 40 40" fill="none">
<title>Twitter</title>
<g id="twitterx1008">
<path id="path1008" d="M6.06736 7L16.8778 20.8991L6.00001 32.2H10.2L18.6 23.1L25.668 32.2H34L22.8 17.5L31.9 7H28.4L20.7 15.4L14.401 7H6.06898H6.06736ZM9.66753 8.73423H12.9327L29.7327 30.4658H26.5697L9.66753 8.73423Z" fill="#5B616B"></path>
</g>
</svg>
</a>
<a class="footer-icon" id="footer_facebook" href="https://www.facebook.com/ncbi.nlm" aria-label="Facebook"><svg xmlns="http://www.w3.org/2000/svg" data-name="Layer 1" viewBox="0 0 300 300">
<title>Facebook</title>
<path class="cls-11" d="M210.5,115.12H171.74V97.82c0-8.14,5.39-10,9.19-10h27.14V52l-39.32-.12c-35.66,0-42.42,26.68-42.42,43.77v19.48H99.09v36.32h27.24v109h45.41v-109h35Z">
</path>
</svg></a>
<a class="footer-icon" id="footer_linkedin" href="https://www.linkedin.com/company/ncbinlm" aria-label="LinkedIn"><svg xmlns="http://www.w3.org/2000/svg" data-name="Layer 1" viewBox="0 0 300 300">
<title>LinkedIn</title>
<path class="cls-11" d="M101.64,243.37H57.79v-114h43.85Zm-22-131.54h-.26c-13.25,0-21.82-10.36-21.82-21.76,0-11.65,8.84-21.15,22.33-21.15S101.7,78.72,102,90.38C102,101.77,93.4,111.83,79.63,111.83Zm100.93,52.61A17.54,17.54,0,0,0,163,182v61.39H119.18s.51-105.23,0-114H163v13a54.33,54.33,0,0,1,34.54-12.66c26,0,44.39,18.8,44.39,55.29v58.35H198.1V182A17.54,17.54,0,0,0,180.56,164.44Z">
</path>
</svg></a>
<a class="footer-icon" id="footer_github" href="https://github.com/ncbi" aria-label="GitHub"><svg xmlns="http://www.w3.org/2000/svg" data-name="Layer 1" viewBox="0 0 300 300">
<defs>
<style>
.cls-11,
.cls-12 {
fill: #737373;
}
.cls-11 {
fill-rule: evenodd;
}
</style>
</defs>
<title>GitHub</title>
<path class="cls-11" d="M151.36,47.28a105.76,105.76,0,0,0-33.43,206.1c5.28,1,7.22-2.3,7.22-5.09,0-2.52-.09-10.85-.14-19.69-29.42,6.4-35.63-12.48-35.63-12.48-4.81-12.22-11.74-15.47-11.74-15.47-9.59-6.56.73-6.43.73-6.43,10.61.75,16.21,10.9,16.21,10.9,9.43,16.17,24.73,11.49,30.77,8.79,1-6.83,3.69-11.5,6.71-14.14C108.57,197.1,83.88,188,83.88,147.51a40.92,40.92,0,0,1,10.9-28.39c-1.1-2.66-4.72-13.42,1-28,0,0,8.88-2.84,29.09,10.84a100.26,100.26,0,0,1,53,0C198,88.3,206.9,91.14,206.9,91.14c5.76,14.56,2.14,25.32,1,28a40.87,40.87,0,0,1,10.89,28.39c0,40.62-24.74,49.56-48.29,52.18,3.79,3.28,7.17,9.71,7.17,19.58,0,14.15-.12,25.54-.12,29,0,2.82,1.9,6.11,7.26,5.07A105.76,105.76,0,0,0,151.36,47.28Z">
</path>
<path class="cls-12" d="M85.66,199.12c-.23.52-1.06.68-1.81.32s-1.2-1.06-.95-1.59,1.06-.69,1.82-.33,1.21,1.07.94,1.6Zm-1.3-1">
</path>
<path class="cls-12" d="M90,203.89c-.51.47-1.49.25-2.16-.49a1.61,1.61,0,0,1-.31-2.19c.52-.47,1.47-.25,2.17.49s.82,1.72.3,2.19Zm-1-1.08">
</path>
<path class="cls-12" d="M94.12,210c-.65.46-1.71,0-2.37-.91s-.64-2.07,0-2.52,1.7,0,2.36.89.65,2.08,0,2.54Zm0,0"></path>
<path class="cls-12" d="M99.83,215.87c-.58.64-1.82.47-2.72-.41s-1.18-2.06-.6-2.7,1.83-.46,2.74.41,1.2,2.07.58,2.7Zm0,0">
</path>
<path class="cls-12" d="M107.71,219.29c-.26.82-1.45,1.2-2.64.85s-2-1.34-1.74-2.17,1.44-1.23,2.65-.85,2,1.32,1.73,2.17Zm0,0">
</path>
<path class="cls-12" d="M116.36,219.92c0,.87-1,1.59-2.24,1.61s-2.29-.68-2.3-1.54,1-1.59,2.26-1.61,2.28.67,2.28,1.54Zm0,0">
</path>
<path class="cls-12" d="M124.42,218.55c.15.85-.73,1.72-2,1.95s-2.37-.3-2.52-1.14.73-1.75,2-2,2.37.29,2.53,1.16Zm0,0"></path>
</svg></a>
<a class="footer-icon" id="footer_blog" href="https://ncbiinsights.ncbi.nlm.nih.gov/" aria-label="Blog">
<svg xmlns="http://www.w3.org/2000/svg" id="Layer_1" data-name="Layer 1" viewBox="0 0 40 40">
<defs><style>.cls-1{fill:#737373;}</style></defs>
<title>NCBI Insights Blog</title>
<path class="cls-1" d="M14,30a4,4,0,1,1-4-4,4,4,0,0,1,4,4Zm11,3A19,19,0,0,0,7.05,15a1,1,0,0,0-1,1v3a1,1,0,0,0,.93,1A14,14,0,0,1,20,33.07,1,1,0,0,0,21,34h3a1,1,0,0,0,1-1Zm9,0A28,28,0,0,0,7,6,1,1,0,0,0,6,7v3a1,1,0,0,0,1,1A23,23,0,0,1,29,33a1,1,0,0,0,1,1h3A1,1,0,0,0,34,33Z"></path>
</svg>
</a>
</div>
</div>
</section>
<section class="container-fluid bg-primary">
<div class="container pt-5">
<div class="row mt-3">
<div class="col-lg-3 col-12">
<p><a class="text-white" href="https://www.nlm.nih.gov/socialmedia/index.html">Connect with NLM</a></p>
<ul class="list-inline social_media">
<li class="list-inline-item"><a href="https://twitter.com/NLM_NIH" aria-label="Twitter" target="_blank" rel="noopener noreferrer">
<svg xmlns="http://www.w3.org/2000/svg" width="35" height="35" viewBox="0 0 36 35" fill="none">
<title>Twitter</title>
<g id="twitterx1009" clip-path="url(#clip0_65276_3946)">
<path id="Vector_Twitter" d="M17.5006 34.6565C26.9761 34.6565 34.6575 26.9751 34.6575 17.4996C34.6575 8.02416 26.9761 0.342773 17.5006 0.342773C8.02514 0.342773 0.34375 8.02416 0.34375 17.4996C0.34375 26.9751 8.02514 34.6565 17.5006 34.6565Z" fill="#205493" stroke="white" stroke-width="1.0" stroke-miterlimit="10"></path>
<path id="path1009" d="M8.54811 8.5L16.2698 18.4279L8.50001 26.5H11.5L17.5 20L22.5486 26.5H28.5L20.5 16L27 8.5H24.5L19 14.5L14.5007 8.5H8.54927H8.54811ZM11.1197 9.73873H13.4519L25.4519 25.2613H23.1926L11.1197 9.73873Z" fill="white"></path>
</g>
<defs>
<clipPath id="clip0_65276_3946">
<rect width="35" height="35" fill="white"></rect>
</clipPath>
</defs>
</svg>
</a></li>
<li class="list-inline-item"><a href="https://www.facebook.com/nationallibraryofmedicine" aria-label="Facebook" rel="noopener noreferrer" target="_blank">
<svg xmlns="http://www.w3.org/2000/svg" width="35" height="35" viewBox="0 0 36 35" fill="none">
<title>Facebook</title>
<g id="Facebook" clip-path="url(#clip0_1717_1086)">
<path id="Vector_Facebook" d="M15.1147 29.1371C15.1147 29.0822 15.1147 29.0296 15.1147 28.9747V18.9414H11.8183C11.6719 18.9414 11.6719 18.9414 11.6719 18.8018C11.6719 17.5642 11.6719 16.3289 11.6719 15.0937C11.6719 14.9793 11.7062 14.9518 11.816 14.9518C12.8683 14.9518 13.9206 14.9518 14.9751 14.9518H15.1215V14.8329C15.1215 13.8057 15.1215 12.774 15.1215 11.7492C15.1274 10.9262 15.3148 10.1146 15.6706 9.37241C16.1301 8.38271 16.9475 7.60378 17.9582 7.19235C18.6492 6.90525 19.3923 6.76428 20.1405 6.7783C21.0029 6.79202 21.8653 6.83091 22.7278 6.86065C22.8879 6.86065 23.048 6.89496 23.2082 6.90182C23.2974 6.90182 23.3271 6.94071 23.3271 7.02993C23.3271 7.54235 23.3271 8.05477 23.3271 8.5649C23.3271 9.16882 23.3271 9.77274 23.3271 10.3767C23.3271 10.4819 23.2974 10.5139 23.1921 10.5116C22.5379 10.5116 21.8814 10.5116 21.2271 10.5116C20.9287 10.5184 20.6316 10.5528 20.3395 10.6146C20.0822 10.6619 19.8463 10.7891 19.6653 10.9779C19.4842 11.1668 19.3672 11.4078 19.3307 11.6669C19.2857 11.893 19.2612 12.1226 19.2575 12.3531C19.2575 13.1904 19.2575 14.0299 19.2575 14.8695C19.2575 14.8946 19.2575 14.9198 19.2575 14.9564H23.0229C23.1807 14.9564 23.183 14.9564 23.1624 15.1074C23.0778 15.7662 22.9885 16.425 22.9039 17.0816C22.8322 17.6321 22.7636 18.1827 22.698 18.7332C22.6729 18.9437 22.6797 18.9437 22.4693 18.9437H19.2644V28.8992C19.2644 28.9793 19.2644 29.0593 19.2644 29.1394L15.1147 29.1371Z" fill="white"></path>
<path id="Vector_2_Facebook" d="M17.5006 34.657C26.9761 34.657 34.6575 26.9756 34.6575 17.5001C34.6575 8.02465 26.9761 0.343262 17.5006 0.343262C8.02514 0.343262 0.34375 8.02465 0.34375 17.5001C0.34375 26.9756 8.02514 34.657 17.5006 34.657Z" stroke="white" stroke-width="1.0" stroke-miterlimit="10"></path>
</g>
<defs>
<clipPath id="clip0_1717_1086">
<rect width="35" height="35" fill="white"></rect>
</clipPath>
</defs>
</svg>
</a></li>
<li class="list-inline-item"><a href="https://www.youtube.com/user/NLMNIH" aria-label="Youtube" target="_blank" rel="noopener noreferrer">
<svg xmlns="http://www.w3.org/2000/svg" width="35" height="35" viewBox="0 0 36 35" fill="none">
<title>Youtube</title>
<g id="YouTube" clip-path="url(#clip0_1717_1101)">
<path id="Vector_Youtube" d="M26.2571 11.4791C25.9025 11.1589 25.5709 10.9576 24.228 10.834C22.5512 10.6785 20.2797 10.6556 18.564 10.6533H16.4365C14.7208 10.6533 12.4493 10.6785 10.7725 10.834C9.43196 10.9576 9.09798 11.1589 8.7434 11.4791C7.81464 12.321 7.6202 14.6268 7.59961 16.8938C7.59961 17.3178 7.59961 17.741 7.59961 18.1635C7.62706 20.4121 7.82837 22.686 8.7434 23.521C9.09798 23.8412 9.42967 24.0425 10.7725 24.1661C12.4493 24.3216 14.7208 24.3445 16.4365 24.3468H18.564C20.2797 24.3468 22.5512 24.3216 24.228 24.1661C25.5686 24.0425 25.9025 23.8412 26.2571 23.521C27.1722 22.6929 27.3735 20.451 27.4009 18.2206C27.4009 17.7402 27.4009 17.2599 27.4009 16.7795C27.3735 14.5491 27.1699 12.3072 26.2571 11.4791ZM15.5604 20.5311V14.652L20.561 17.5001L15.5604 20.5311Z" fill="white"></path>
<path id="Vector_2_Youtube" d="M17.5006 34.657C26.9761 34.657 34.6575 26.9756 34.6575 17.5001C34.6575 8.02465 26.9761 0.343262 17.5006 0.343262C8.02514 0.343262 0.34375 8.02465 0.34375 17.5001C0.34375 26.9756 8.02514 34.657 17.5006 34.657Z" stroke="white" stroke-width="1.0" stroke-miterlimit="10"></path>
</g>
<defs>
<clipPath id="clip0_1717_1101">
<rect width="35" height="35" fill="white"></rect>
</clipPath>
</defs>
</svg>
</a></li>
</ul>
</div>
<div class="col-lg-3 col-12">
<p class="address_footer text-white">National Library of Medicine<br />
<a href="https://www.google.com/maps/place/8600+Rockville+Pike,+Bethesda,+MD+20894/@38.9959508,-77.101021,17z/data=!3m1!4b1!4m5!3m4!1s0x89b7c95e25765ddb:0x19156f88b27635b8!8m2!3d38.9959508!4d-77.0988323" class="text-white" target="_blank" rel="noopener noreferrer">8600 Rockville Pike<br />
Bethesda, MD 20894</a></p>
</div>
<div class="col-lg-3 col-12 centered-lg">
<p><a href="https://www.nlm.nih.gov/web_policies.html" class="text-white">Web Policies</a><br />
<a href="https://www.nih.gov/institutes-nih/nih-office-director/office-communications-public-liaison/freedom-information-act-office" class="text-white">FOIA</a><br />
<a href="https://www.hhs.gov/vulnerability-disclosure-policy/index.html" class="text-white" id="vdp">HHS Vulnerability Disclosure</a></p>
</div>
<div class="col-lg-3 col-12 centered-lg">
<p><a class="supportLink text-white" href="https://support.nlm.nih.gov/">Help</a><br />
<a href="https://www.nlm.nih.gov/accessibility.html" class="text-white">Accessibility</a><br />
<a href="https://www.nlm.nih.gov/careers/careers.html" class="text-white">Careers</a></p>
</div>
</div>
<div class="row">
<div class="col-lg-12 centered-lg">
<nav class="bottom-links">
<ul class="mt-3">
<li>
<a class="text-white" href="//www.nlm.nih.gov/">NLM</a>
</li>
<li>
<a class="text-white" href="https://www.nih.gov/">NIH</a>
</li>
<li>
<a class="text-white" href="https://www.hhs.gov/">HHS</a>
</li>
<li>
<a class="text-white" href="https://www.usa.gov/">USA.gov</a>
</li>
</ul>
</nav>
</div>
</div>
</div>
</section>
<script type="text/javascript" src="/portal/portal3rc.fcgi/rlib/js/InstrumentOmnitureBaseJS/InstrumentNCBIConfigJS/InstrumentNCBIBaseJS/InstrumentPageStarterJS.js?v=1"> </script>
<script type="text/javascript" src="/portal/portal3rc.fcgi/static/js/hfjs2.js"> </script>
</div>
</div>
<!--/.footer-->
</div>
<!--/.page-->
</div>
<!--/.wrap-->
<span class="PAFAppResources"></span>
</div><!-- /.twelve_col -->
</div>
<!-- /.grid -->
<!-- usually for JS scripts at page bottom -->
<span class="pagefixtures"></span>
<!-- CE8BC1E97D9F05E1_0182SID /projects/staticsites/genbank/genbank@2.21 portal107 v4.1.r689238 Tue, Oct 22 2024 16:10:51 -->
<span id="portal-csrf-token" style="display:none" data-token="CE8BC1E97D9F05E1_0182SID"></span>
<script type="text/javascript" src="//static.pubmed.gov/portal/portal3rc.fcgi/4218137/js/3879255/4121861/1490097/4087685.js" snapshot="genbank"></script></body>
</html>
Reference in a new issue View git blame Copy permalink